StarFunc result for job id P11473

User Input

>input (427 residues)
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8P8	0.921	0.921	1.415E-58	427	1.000	1.000	F1D8P8.pdb.gz	F1D8P8_HUMAN Vitamin D3 receptor OS=Homo sapiens OX=9606 GN=NR1i1 PE=2 SV=1
2	AFDB:P48281	0.878	0.888	6.599E-53	422	0.881	0.891	P48281.pdb.gz	VDR_MOUSE Vitamin D3 receptor OS=Mus musculus OX=10090 GN=Vdr PE=1 SV=2
3	AFDB:O42392	0.771	0.733	7.113E-50	451	0.801	0.758	O42392.pdb.gz	VDR_CHICK Vitamin D3 receptor OS=Gallus gallus OX=9031 GN=VDR PE=2 SV=1
4	AFDB:Q1L673	0.829	0.838	3.316E-44	422	0.691	0.699	Q1L673.pdb.gz	VDRB_DANRE Vitamin D3 receptor B OS=Danio rerio OX=7955 GN=vdrb PE=2 SV=2
5	AFDB:Q9PTN2	0.736	0.698	1.304E-43	453	0.693	0.653	Q9PTN2.pdb.gz	VDRA_DANRE Vitamin D3 receptor A OS=Danio rerio OX=7955 GN=vdra PE=1 SV=2
6	AFDB:A0A3G3LJZ1	0.540	0.535	8.911E-30	431	0.393	0.390	A0A3G3LJZ1.pdb.gz
7	AFDB:Q9DFH3	0.542	0.591	2.732E-28	391	0.370	0.404	Q9DFH3.pdb.gz	Q9DFH3_CHICK Xenobiotic receptor OS=Gallus gallus OX=9031 GN=CXR PE=2 SV=1
8	AFDB:H0Y8E2	0.526	0.564	1.695E-27	397	0.384	0.413	H0Y8E2.pdb.gz	H0Y8E2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
9	AFDB:F1D8P9	0.550	0.500	6.667E-27	473	0.391	0.353	F1D8P9.pdb.gz	F1D8P9_HUMAN Nuclear receptor subfamily 1, group I, member 2, isoform CRA_b OS=Homo sapiens OX=9606 GN=NR1i2 PE=2 SV=1
10	AFDB:O54915	0.530	0.525	9.847E-26	431	0.379	0.376	O54915.pdb.gz	NR1I2_MOUSE Nuclear receptor subfamily 1 group I member 2 OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1
11	PDB:3dzyA	0.413	0.574	1.503E-12	302	0.183	0.258	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.481	0.838	9.370E-10	238	0.148	0.265	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.359	0.600	7.010E-7	246	0.103	0.179	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.402	0.638	5.465E-6	259	0.101	0.166	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:6xz6A	0.135	0.232	4.929E-1	213	0.070	0.141	6xz6A.pdb.gz
16	PDB:6nwdA	0.102	0.155	6.784E-1	246	0.059	0.102	6nwdA.pdb.gz	X-ray Crystallographic Structure and Oligomerization of Gloeobacter Rhodopsin.
17	PDB:6o8cA	0.089	0.064	8.523E-1	636	0.066	0.044	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
18	PDB:1jqiA	0.084	0.089	8.921E-1	384	0.047	0.052	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
19	PDB:1tt9A	0.093	0.077	9.773E-1	540	0.056	0.044	1tt9A.pdb.gz
20	PDB:6vkzA	0.118	0.118	1.023	429	0.068	0.068	6vkzA.pdb.gz	Algal neurotoxin biosynthesis repurposes the terpene cyclase structural fold into anN-prenyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5K1VW50	0.0	882	494	1.000	0.864	A0A5K1VW50_HUMAN Vitamin D3 receptor OS=Homo sapiens OX=9606 GN=VDR PE=1 SV=1
2	F1D8P8	0.0	885	427	1.000	1.000	F1D8P8_HUMAN Vitamin D3 receptor OS=Homo sapiens OX=9606 GN=NR1i1 PE=2 SV=1
3	F8VRJ4	0.0	521	250	0.585	1.000	F8VRJ4_HUMAN Vitamin D3 receptor (Fragment) OS=Homo sapiens OX=9606 GN=VDR PE=1 SV=1
4	O42392	0.0	706	451	0.801	0.758	VDR_CHICK Vitamin D3 receptor OS=Gallus gallus OX=9031 GN=VDR PE=2 SV=1
5	P11473	0.0	885	427	1.000	1.000	VDR_HUMAN Vitamin D3 receptor OS=Homo sapiens OX=9606 GN=VDR PE=1 SV=1
6	P13053	0.0	761	423	0.895	0.903	VDR_RAT Vitamin D3 receptor OS=Rattus norvegicus OX=10116 GN=Vdr PE=1 SV=1
7	P48281	0.0	752	422	0.867	0.877	VDR_MOUSE Vitamin D3 receptor OS=Mus musculus OX=10090 GN=Vdr PE=1 SV=2
8	Q1L673	0.0	601	422	0.705	0.713	VDRB_DANRE Vitamin D3 receptor B OS=Danio rerio OX=7955 GN=vdrb PE=2 SV=2
9	Q9PTN2	0.0	618	453	0.719	0.678	VDRA_DANRE Vitamin D3 receptor A OS=Danio rerio OX=7955 GN=vdra PE=1 SV=2
10	O75469	1.03e-100	308	434	0.403	0.396	NR1I2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
11	J3KPQ3	1.37e-100	308	434	0.403	0.396	J3KPQ3_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
12	F1D8P9	3.38e-100	308	473	0.403	0.364	F1D8P9_HUMAN Nuclear receptor subfamily 1, group I, member 2, isoform CRA_b OS=Homo sapiens OX=9606 GN=NR1i2 PE=2 SV=1
13	H0Y8E2	3.77e-96	295	397	0.384	0.413	H0Y8E2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
14	A5WYG8	1.45e-95	295	430	0.398	0.395	A5WYG8_DANRE Nuclear receptor subfamily 1 group I member 2 OS=Danio rerio OX=7955 GN=PXR PE=2 SV=1
15	B0V1H8	3.26e-95	294	430	0.398	0.395	B0V1H8_DANRE Nuclear receptor subfamily 1 group I member 2 isoform X1 OS=Danio rerio OX=7955 GN=PXR PE=3 SV=1
16	A5J0K7	2.55e-93	289	421	0.382	0.387	A5J0K7_PIG Pregnane X receptor OS=Sus scrofa OX=9823 GN=PXR PE=2 SV=1
17	O54915	5.89e-93	288	431	0.391	0.387	NR1I2_MOUSE Nuclear receptor subfamily 1 group I member 2 OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1
18	Q2V0W2	1.30e-92	287	421	0.379	0.385	Q2V0W2_PIG Pregnane X receptor OS=Sus scrofa OX=9823 GN=PXR PE=2 SV=1
19	Q9R1A7	2.80e-90	281	431	0.379	0.376	NR1I2_RAT Nuclear receptor subfamily 1 group I member 2 OS=Rattus norvegicus OX=10116 GN=Nr1i2 PE=2 SV=1
20	Q9DFH3	1.30e-84	266	391	0.386	0.422	Q9DFH3_CHICK Xenobiotic receptor OS=Gallus gallus OX=9031 GN=CXR PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	5.7e-18	76.8	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	3.1e-25	99.7	Zinc finger, C4 type (two domains)
3	PF17026 zf-RRPl_C4	3.4e+02	12.7	Putative ribonucleoprotein zinc-finger pf C4 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000447173

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385216	0.998	Nuclear receptor coactivator 1
2	9606.ENSP00000419692	0.998	Retinoic acid receptor RXR-alpha
3	9606.ENSP00000228606	0.994	25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
4	9606.ENSP00000332973	0.992	Mothers against decapentaplegic homolog 3
5	9606.ENSP00000300651	0.990	Mediator of RNA polymerase II transcription subunit 1
6	9606.ENSP00000344456	0.985	Catenin beta-1
7	9606.ENSP00000342434	0.982	Tyrosine-protein kinase BAZ1B
8	9606.ENSP00000263253	0.979	Histone acetyltransferase p300
9	9606.ENSP00000361066	0.977	Nuclear receptor coactivator 3
10	9606.ENSP00000421725	0.976	Vitamin D-binding protein
11	9606.ENSP00000262367	0.974	CREB-binding protein
12	9606.ENSP00000268712	0.972	Nuclear receptor corepressor 1
13	9606.ENSP00000378414	0.969	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
14	9606.ENSP00000399968	0.966	Nuclear receptor coactivator 2
15	9606.ENSP00000341551	0.955	Mothers against decapentaplegic homolog 4
16	9606.ENSP00000352900	0.954	Retinoic acid receptor RXR-gamma
17	9606.ENSP00000262971	0.939	E3 SUMO-protein ligase PIAS4
18	9606.ENSP00000363817	0.937	Retinoic acid receptor RXR-beta
19	9606.ENSP00000216862	0.921	1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
20	9606.ENSP00000388510	0.918	Retinoic acid receptor gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004879	1.000	nuclear receptor activity
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0036094	0.998	small molecule binding
GO:0005515	0.998	protein binding
GO:0008289	0.996	lipid binding
GO:0019842	0.992	vitamin binding
GO:0005496	0.984	steroid binding
GO:0000977	0.893	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.812	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.991	cellular process
GO:0010468	0.988	regulation of gene expression
GO:0050896	0.987	response to stimulus
GO:0080090	0.985	regulation of primary metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0042221	0.969	response to chemical
GO:0031326	0.966	regulation of cellular biosynthetic process
GO:0019219	0.966	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.960	regulation of macromolecule biosynthetic process
GO:0051252	0.956	regulation of RNA metabolic process
GO:1903506	0.945	regulation of nucleic acid-templated transcription
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0048518	0.933	positive regulation of biological process
GO:0032501	0.917	multicellular organismal process
GO:0048856	0.910	anatomical structure development
GO:0048522	0.863	positive regulation of cellular process
GO:0009893	0.756	positive regulation of metabolic process
GO:0009605	0.754	response to external stimulus
GO:0008152	0.745	metabolic process
GO:0031667	0.702	response to nutrient levels
GO:0007584	0.687	response to nutrient
GO:0071704	0.673	organic substance metabolic process
GO:0007154	0.662	cell communication
GO:0044238	0.658	primary metabolic process
GO:0010604	0.651	positive regulation of macromolecule metabolic process
GO:0044237	0.643	cellular metabolic process
GO:0051716	0.609	cellular response to stimulus
GO:0010033	0.596	response to organic substance
GO:0006807	0.590	nitrogen compound metabolic process
GO:0051173	0.539	positive regulation of nitrogen compound metabolic process
GO:0031325	0.537	positive regulation of cellular metabolic process
GO:0023052	0.518	signaling
GO:0043170	0.512	macromolecule metabolic process
GO:0045935	0.510	positive regulation of nucleobase-containing compound metabolic process
GO:0033273	0.478	response to vitamin
GO:0048519	0.471	negative regulation of biological process
GO:0007275	0.464	multicellular organism development
GO:0006357	0.460	regulation of transcription by RNA polymerase II
GO:0031328	0.445	positive regulation of cellular biosynthetic process
GO:0045893	0.436	positive regulation of DNA-templated transcription
GO:0048523	0.431	negative regulation of cellular process
GO:0007165	0.418	signal transduction
GO:0033993	0.416	response to lipid
GO:0009892	0.408	negative regulation of metabolic process
GO:0048583	0.368	regulation of response to stimulus
GO:0010605	0.346	negative regulation of macromolecule metabolic process
GO:1901700	0.341	response to oxygen-containing compound
GO:0051239	0.336	regulation of multicellular organismal process
GO:0045944	0.321	positive regulation of transcription by RNA polymerase II
GO:0070887	0.314	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0005829	0.922	cytosol
GO:0032991	0.473	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]