StarFunc result for job id P11474

User Input

>input (423 residues)
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A6E1WCP9	0.564	0.474	2.594E-53	506	0.995	0.832	A0A6E1WCP9.pdb.gz	A0A6E1WCP9_HUMAN Estrogen related receptor alpha OS=Homo sapiens OX=9606 GN=ESRRA PE=1 SV=1
2	AFDB:Q6Q6F6	0.539	0.524	7.500E-40	436	0.657	0.638	Q6Q6F6.pdb.gz	Q6Q6F6_DANRE Estrogen-related receptor alpha OS=Danio rerio OX=7955 GN=erralpha PE=1 SV=1
3	AFDB:F6PD98	0.529	0.448	8.778E-39	501	0.596	0.503	F6PD98.pdb.gz	F6PD98_DANRE Estrogen-related receptor gamma a OS=Danio rerio OX=7955 GN=errg PE=3 SV=1
4	AFDB:Q5RJ38	0.527	0.502	1.098E-38	444	0.598	0.570	Q5RJ38.pdb.gz	Q5RJ38_DANRE Estrogen-related receptor gamma b OS=Danio rerio OX=7955 GN=errb/g PE=3 SV=2
5	AFDB:A0A2R8Y491	0.539	0.503	2.685E-38	454	0.589	0.548	A0A2R8Y491.pdb.gz	A0A2R8Y491_HUMAN Estrogen related receptor beta OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=1
6	AFDB:P62508	0.525	0.485	3.673E-38	458	0.596	0.550	P62508.pdb.gz	ERR3_HUMAN Estrogen-related receptor gamma OS=Homo sapiens OX=9606 GN=ESRRG PE=1 SV=1
7	AFDB:Q6Q6F3	0.529	0.646	2.063E-32	344	0.485	0.596	Q6Q6F3.pdb.gz
8	AFDB:Q8WS79	0.504	0.431	7.919E-28	496	0.423	0.361	Q8WS79.pdb.gz	Q8WS79_DROME Estrogen-related receptor splice variant OS=Drosophila melanogaster OX=7227 GN=ERR PE=2 SV=1
9	AFDB:P57717	0.509	0.381	1.855E-25	569	0.359	0.267	P57717.pdb.gz	ESR1_DANRE Estrogen receptor OS=Danio rerio OX=7955 GN=esr1 PE=2 SV=2
10	AFDB:Q7LCB3	0.503	0.405	1.855E-25	530	0.364	0.291	Q7LCB3.pdb.gz	Q7LCB3_HUMAN Estrogen receptor beta OS=Homo sapiens OX=9606 GN=NR3A2 PE=2 SV=1
11	PDB:3dzyA	0.444	0.614	1.482E-17	302	0.258	0.361	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:1g2nA	0.438	0.734	7.294E-10	246	0.156	0.268	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.458	0.785	4.365E-9	238	0.144	0.256	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.422	0.669	1.021E-8	259	0.151	0.247	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7o3vF	0.110	0.155	2.937E-1	261	0.069	0.111	7o3vF.pdb.gz
16	PDB:1qoyA	0.085	0.110	4.393E-1	303	0.083	0.116	1qoyA.pdb.gz
17	PDB:7ocaI	0.113	0.218	4.594E-1	185	0.047	0.108	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
18	PDB:4povA	0.138	0.253	5.024E-1	178	0.061	0.146	4povA.pdb.gz	Structure-Based Design of Potent Small-Molecule Binders to the S-Component of the ECF Transporter for Thiamine.
19	PDB:6xz6A	0.125	0.220	5.494E-1	213	0.061	0.122	6xz6A.pdb.gz
20	PDB:7o3vI	0.090	0.156	6.283E-1	193	0.069	0.150	7o3vI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6E1WCP9	0.0	836	506	0.998	0.834	A0A6E1WCP9_HUMAN Estrogen related receptor alpha OS=Homo sapiens OX=9606 GN=ESRRA PE=1 SV=1
2	O08580	0.0	825	422	0.981	0.983	ERR1_MOUSE Steroid hormone receptor ERR1 OS=Mus musculus OX=10090 GN=Esrra PE=1 SV=4
3	P11474	0.0	844	423	1.000	1.000	ERR1_HUMAN Steroid hormone receptor ERR1 OS=Homo sapiens OX=9606 GN=ESRRA PE=1 SV=3
4	Q569H8	0.0	844	423	1.000	1.000	Q569H8_HUMAN ESRRA protein OS=Homo sapiens OX=9606 GN=ESRRA PE=2 SV=1
5	Q5QJV7	0.0	825	422	0.981	0.983	ERR1_RAT Steroid hormone receptor ERR1 OS=Rattus norvegicus OX=10116 GN=Esrra PE=1 SV=2
6	P62508	1.30e-174	498	458	0.551	0.509	ERR3_HUMAN Estrogen-related receptor gamma OS=Homo sapiens OX=9606 GN=ESRRG PE=1 SV=1
7	P62509	1.30e-174	498	458	0.551	0.509	ERR3_MOUSE Estrogen-related receptor gamma OS=Mus musculus OX=10090 GN=Esrrg PE=1 SV=1
8	Q6Q6F4	1.93e-173	494	435	0.600	0.584	Q6Q6F4_DANRE Estrogen-related receptor gamma OS=Danio rerio OX=7955 GN=errgamma PE=2 SV=1
9	F6PD98	6.09e-173	495	501	0.600	0.507	F6PD98_DANRE Estrogen-related receptor gamma a OS=Danio rerio OX=7955 GN=errg PE=3 SV=1
10	Q6Q6F6	1.55e-169	484	436	0.622	0.603	Q6Q6F6_DANRE Estrogen-related receptor alpha OS=Danio rerio OX=7955 GN=erralpha PE=1 SV=1
11	E7EWD9	5.70e-162	464	438	0.596	0.575	E7EWD9_HUMAN Estrogen related receptor beta OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=2
12	O95718	1.34e-161	464	433	0.596	0.582	ERR2_HUMAN Steroid hormone receptor ERR2 OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=3
13	A0A2R8Y491	2.46e-161	464	454	0.596	0.555	A0A2R8Y491_HUMAN Estrogen related receptor beta OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=1
14	P11475	1.05e-160	461	433	0.589	0.575	ERR2_RAT Steroid hormone receptor ERR2 OS=Rattus norvegicus OX=10116 GN=Esrrb PE=2 SV=1
15	B3DIZ0	3.49e-160	459	420	0.556	0.560	B3DIZ0_DANRE Estrogen-related receptor gamma b OS=Danio rerio OX=7955 GN=errbeta/gamma PE=2 SV=1
16	Q5RJ38	6.77e-160	459	444	0.556	0.529	Q5RJ38_DANRE Estrogen-related receptor gamma b OS=Danio rerio OX=7955 GN=errb/g PE=3 SV=2
17	Q61539	3.64e-156	450	433	0.577	0.564	ERR2_MOUSE Steroid hormone receptor ERR2 OS=Mus musculus OX=10090 GN=Esrrb PE=1 SV=2
18	Q9VSE9	3.56e-83	265	484	0.392	0.343	Q9VSE9_DROME Estrogen-related receptor OS=Drosophila melanogaster OX=7227 GN=ERR PE=1 SV=1
19	Q8WS79	7.30e-83	264	496	0.392	0.335	Q8WS79_DROME Estrogen-related receptor splice variant OS=Drosophila melanogaster OX=7227 GN=ERR PE=2 SV=1
20	P06211	1.90e-79	258	600	0.366	0.258	ESR1_RAT Estrogen receptor OS=Rattus norvegicus OX=10116 GN=Esr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	1.8e-24	98.1	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	2.7e-27	106.4	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384851

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264867	0.999	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
2	9606.ENSP00000312649	0.960	Peroxisome proliferator-activated receptor gamma coactivator 1-beta
3	9606.ENSP00000307786	0.945	Cytochrome c
4	9606.ENSP00000414022	0.938	PGC-1 and ERR-induced regulator in muscle protein 1
5	9606.ENSP00000262030	0.936	ATP synthase subunit beta, mitochondrial
6	9606.ENSP00000340874	0.928	Myocyte-specific enhancer factor 2C
7	9606.ENSP00000360493	0.927	Runt-related transcription factor 2
8	9606.ENSP00000385523	0.927	Peroxisome proliferator-activated receptor alpha
9	9606.ENSP00000437955	0.926	Hypoxia-inducible factor 1-alpha
10	9606.ENSP00000346389	0.924	Myocyte-specific enhancer factor 2A
11	9606.ENSP00000271555	0.916	Myocyte-specific enhancer factor 2D
12	9606.ENSP00000378416	0.909	5-aminolevulinate synthase, nonspecific, mitochondrial
13	9606.ENSP00000405330	0.897	Estrogen receptor
14	9606.ENSP00000387699	0.889	Cyclic AMP-responsive element-binding protein 1
15	9606.ENSP00000376924	0.881	Nuclear respiratory factor 1
16	9606.ENSP00000383063	0.867	Nuclear receptor-interacting protein 1
17	9606.ENSP00000363804	0.850	Krueppel-like factor 4
18	9606.ENSP00000361066	0.815	Nuclear receptor coactivator 3
19	9606.ENSP00000385216	0.814	Nuclear receptor coactivator 1
20	9606.ENSP00000355904	0.799	Estrogen-related receptor gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	0.999	sequence-specific DNA binding
GO:0005515	0.998	protein binding
GO:0000981	0.987	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003690	0.983	double-stranded DNA binding
GO:1990837	0.951	sequence-specific double-stranded DNA binding
GO:0038023	0.932	signaling receptor activity
GO:0000976	0.841	transcription cis-regulatory region binding
GO:0098531	0.500	ligand-activated transcription factor activity
GO:0000977	0.488	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008134	0.478	transcription factor binding
GO:0000987	0.432	cis-regulatory region sequence-specific DNA binding
GO:0004879	0.414	nuclear receptor activity
GO:0000978	0.360	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.996	regulation of DNA-templated transcription
GO:0048518	0.823	positive regulation of biological process
GO:0048522	0.803	positive regulation of cellular process
GO:0009893	0.679	positive regulation of metabolic process
GO:0051173	0.674	positive regulation of nitrogen compound metabolic process
GO:0010604	0.672	positive regulation of macromolecule metabolic process
GO:0031325	0.626	positive regulation of cellular metabolic process
GO:0045935	0.534	positive regulation of nucleobase-containing compound metabolic process
GO:0009987	0.506	cellular process
GO:0048519	0.497	negative regulation of biological process
GO:0031328	0.461	positive regulation of cellular biosynthetic process
GO:0010557	0.447	positive regulation of macromolecule biosynthetic process
GO:0045893	0.438	positive regulation of DNA-templated transcription
GO:0048523	0.433	negative regulation of cellular process
GO:0006357	0.424	regulation of transcription by RNA polymerase II
GO:0045944	0.398	positive regulation of transcription by RNA polymerase II
GO:0009892	0.389	negative regulation of metabolic process
GO:0010605	0.335	negative regulation of macromolecule metabolic process
GO:0008152	0.334	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005737	0.915	cytoplasm
GO:0005730	0.445	nucleolus
GO:0005856	0.370	cytoskeleton
GO:0032991	0.368	protein-containing complex
GO:0045171	0.343	intercellular bridge
GO:0001650	0.334	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]