StarFunc result for job id P11487

User Input

>input (239 residues)
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11487	1.000	1.000	1.427E-43	239	1.000	1.000	P11487.pdb.gz	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
2	AFDB:P05524	0.806	0.787	6.200E-37	245	0.816	0.796	P05524.pdb.gz	FGF3_MOUSE Fibroblast growth factor 3 OS=Mus musculus OX=10090 GN=Fgf3 PE=1 SV=3
3	AFDB:P48802	0.678	0.634	2.948E-27	256	0.577	0.539	P48802.pdb.gz	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
4	AFDB:Q2HXK8	0.569	0.667	5.119E-18	203	0.272	0.320	Q2HXK8.pdb.gz	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
5	AFDB:O43320	0.566	0.650	1.326E-17	207	0.297	0.343	O43320.pdb.gz	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
6	AFDB:A0A2R8QRV4	0.520	0.552	1.568E-17	225	0.285	0.302	A0A2R8QRV4.pdb.gz
7	AFDB:Q2LJ24	0.577	0.660	1.659E-17	208	0.314	0.361	Q2LJ24.pdb.gz	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
8	AFDB:P12034	0.524	0.469	2.075E-17	268	0.310	0.276	P12034.pdb.gz	FGF5_HUMAN Fibroblast growth factor 5 OS=Homo sapiens OX=9606 GN=FGF5 PE=1 SV=4
9	AFDB:Q38PL0	0.568	0.650	2.075E-17	208	0.318	0.365	Q38PL0.pdb.gz	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
10	AFDB:Q9EST9	0.568	0.638	2.075E-17	212	0.322	0.363	Q9EST9.pdb.gz	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
11	PDB:3f1rA	0.566	0.850	4.829E-17	157	0.289	0.439	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
12	PDB:4jq0A	0.512	0.854	7.768E-13	141	0.192	0.326	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.489	0.765	5.175E-11	151	0.201	0.318	1ry7A.pdb.gz
14	PDB:6b0tA	0.463	0.234	1.368E-5	487	0.105	0.051	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4qd2B	0.389	0.622	6.937E-5	143	0.067	0.112	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	PDB:7t3qA	0.409	0.053	2.659E-4	2103	0.121	0.014	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:3malA	0.363	0.467	3.327E-4	181	0.096	0.127	3malA.pdb.gz
18	PDB:1t9fA	0.369	0.486	4.401E-4	178	0.084	0.112	1t9fA.pdb.gz
19	PDB:7vmlA	0.396	0.030	6.888E-4	4044	0.092	0.005	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.
20	PDB:3wmuB	0.334	0.497	7.704E-4	153	0.100	0.157	3wmuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11487	7.16e-175	482	239	1.000	1.000	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
2	P05524	1.03e-130	370	245	0.812	0.792	FGF3_MOUSE Fibroblast growth factor 3 OS=Mus musculus OX=10090 GN=Fgf3 PE=1 SV=3
3	P48802	1.51e-89	266	256	0.544	0.508	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
4	O15520	9.54e-39	135	208	0.301	0.346	FGF10_HUMAN Fibroblast growth factor 10 OS=Homo sapiens OX=9606 GN=FGF10 PE=1 SV=1
5	P70492	1.16e-38	135	215	0.301	0.335	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
6	O43320	3.83e-37	131	207	0.280	0.324	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
7	O54769	8.86e-37	130	207	0.276	0.319	FGF16_RAT Fibroblast growth factor 16 OS=Rattus norvegicus OX=10116 GN=Fgf16 PE=2 SV=1
8	O35565	1.69e-36	129	209	0.285	0.325	FGF10_MOUSE Fibroblast growth factor 10 OS=Mus musculus OX=10090 GN=Fgf10 PE=2 SV=1
9	P36364	1.72e-36	129	208	0.276	0.317	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
10	P54130	1.72e-36	129	208	0.276	0.317	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
11	P31371	1.99e-36	129	208	0.276	0.317	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
12	O42407	2.84e-36	129	212	0.276	0.311	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
13	Q2LJ24	5.04e-35	125	208	0.301	0.346	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
14	Q9ESL9	7.61e-35	125	211	0.301	0.341	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
15	Q9EST9	1.78e-34	124	212	0.301	0.340	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
16	Q9NP95	2.67e-34	124	211	0.272	0.308	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
17	Q38PL0	3.29e-33	121	208	0.289	0.332	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
18	Q2HXK8	4.97e-33	120	203	0.259	0.305	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
19	P48807	1.99e-32	120	266	0.276	0.248	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
20	P15656	2.81e-32	120	264	0.276	0.250	FGF5_MOUSE Fibroblast growth factor 5 OS=Mus musculus OX=10090 GN=Fgf5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	6.6e-44	160.3	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334122

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410294	0.953	Fibroblast growth factor receptor 2
2	9606.ENSP00000393312	0.949	Fibroblast growth factor receptor 1
3	9606.ENSP00000407586	0.941	GTPase HRas
4	9606.ENSP00000263025	0.934	Mitogen-activated protein kinase 3
5	9606.ENSP00000256078	0.921	GTPase KRas
6	9606.ENSP00000339824	0.921	Fibroblast growth factor receptor 3
7	9606.ENSP00000215832	0.920	Mitogen-activated protein kinase 1
8	9606.ENSP00000371770	0.920	Fibroblast growth factor-binding protein 1
9	9606.ENSP00000292408	0.919	Fibroblast growth factor receptor 4
10	9606.ENSP00000358548	0.917	GTPase NRas
11	9606.ENSP00000259989	0.908	Fibroblast growth factor binding protein 2
12	9606.ENSP00000339067	0.900	Fibroblast growth factor-binding protein 3
13	9606.ENSP00000381498	0.893	Fibroblast growth factor receptor-like 1
14	9606.ENSP00000352414	0.833	Fibroblast growth factor 17
15	9606.ENSP00000263923	0.804	Vascular endothelial growth factor receptor 2
16	9606.ENSP00000275493	0.785	Epidermal growth factor receptor
17	9606.ENSP00000282397	0.780	Vascular endothelial growth factor receptor 1
18	9606.ENSP00000288135	0.777	Mast/stem cell growth factor receptor Kit
19	9606.ENSP00000269571	0.776	Receptor tyrosine-protein kinase erbB-2
20	9606.ENSP00000321835	0.770	ETS translocation variant 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.995	growth factor activity
GO:0070851	0.597	growth factor receptor binding
GO:0005104	0.553	fibroblast growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0048856	0.994	anatomical structure development
GO:0007165	0.990	signal transduction
GO:0048518	0.987	positive regulation of biological process
GO:0048522	0.982	positive regulation of cellular process
GO:0007166	0.975	cell surface receptor signaling pathway
GO:0042127	0.961	regulation of cell population proliferation
GO:0008543	0.959	fibroblast growth factor receptor signaling pathway
GO:0050793	0.955	regulation of developmental process
GO:0051239	0.924	regulation of multicellular organismal process
GO:0008284	0.923	positive regulation of cell population proliferation
GO:0032501	0.874	multicellular organismal process
GO:0048519	0.786	negative regulation of biological process
GO:0007267	0.778	cell-cell signaling
GO:0007275	0.738	multicellular organism development
GO:0019222	0.702	regulation of metabolic process
GO:0048731	0.661	system development
GO:0009653	0.581	anatomical structure morphogenesis
GO:0048513	0.568	animal organ development
GO:0048583	0.564	regulation of response to stimulus
GO:0010646	0.548	regulation of cell communication
GO:0023051	0.547	regulation of signaling
GO:0009966	0.498	regulation of signal transduction
GO:0048523	0.467	negative regulation of cellular process
GO:0009893	0.454	positive regulation of metabolic process
GO:0060255	0.452	regulation of macromolecule metabolic process
GO:0031323	0.438	regulation of cellular metabolic process
GO:0051171	0.384	regulation of nitrogen compound metabolic process
GO:0030154	0.382	cell differentiation
GO:0080090	0.375	regulation of primary metabolic process
GO:0048584	0.371	positive regulation of response to stimulus
GO:0010604	0.369	positive regulation of macromolecule metabolic process
GO:0048634	0.360	regulation of muscle organ development
GO:1901861	0.351	regulation of muscle tissue development
GO:0009967	0.349	positive regulation of signal transduction
GO:0031325	0.327	positive regulation of cellular metabolic process
GO:0051173	0.324	positive regulation of nitrogen compound metabolic process
GO:0010468	0.305	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005622	0.978	intracellular anatomical structure
GO:0043226	0.974	organelle
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0071944	0.936	cell periphery
GO:0012505	0.916	endomembrane system
GO:0005737	0.904	cytoplasm
GO:0005886	0.468	plasma membrane
GO:0005615	0.397	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]