StarFunc result for job id P11498

User Input

>input (1178 residues)
MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELG
IRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGF
LSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEA
HEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIE
KPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAK
QVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDL
GLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISP
HYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQF
IDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPPPAG
FRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSK
LFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVF
KFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSL
QYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGV
AAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEG
ARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQM
LGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFP
EPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHF
KDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFEL
NGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVL
SAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3bg5A	0.837	0.865	0.000	1137	0.464	0.481	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
2	PDB:3bg5B	0.797	0.872	0.000	1074	0.440	0.482	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
3	PDB:4hnvB	0.761	0.864	0.000	1033	0.419	0.478	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
4	PDB:7wtbB	0.884	0.907	0.000	1147	0.974	1.000	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.
5	AFDB:A0A024R5C5	0.968	0.968	0.000	1178	1.000	1.000	A0A024R5C5.pdb.gz
6	AFDB:A0A0H3JRU9	0.868	0.888	0.000	1150	0.469	0.481	A0A0H3JRU9.pdb.gz	PYC_STAAM Pyruvate carboxylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=pycA PE=1 SV=1
7	AFDB:A0A0R4IFJ4	0.972	0.969	0.000	1181	0.832	0.830	A0A0R4IFJ4.pdb.gz	A0A0R4IFJ4_DANRE Pyruvate carboxylase OS=Danio rerio OX=7955 GN=PYCa PE=1 SV=1
8	AFDB:B3DGZ9	0.920	0.918	0.000	1181	0.829	0.826	B3DGZ9.pdb.gz
9	AFDB:O17732	0.900	0.902	0.000	1175	0.642	0.643	O17732.pdb.gz	PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans OX=6239 GN=pyc-1 PE=1 SV=1
10	AFDB:P32327	0.899	0.898	0.000	1180	0.525	0.524	P32327.pdb.gz	PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PYC2 PE=1 SV=2
11	AFDB:P95127	0.866	0.902	0.000	1127	0.453	0.474	P95127.pdb.gz	P95127_MYCTO Pyruvate carboxylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pca PE=4 SV=2
12	AFDB:Q0E9E2	0.903	0.889	0.000	1197	0.678	0.668	Q0E9E2.pdb.gz	Q0E9E2_DROME Pyruvate carboxylase OS=Drosophila melanogaster OX=7227 GN=PCB PE=1 SV=1
13	AFDB:Q5B4R8	0.933	0.919	0.000	1196	0.526	0.518	Q5B4R8.pdb.gz	Q5B4R8_EMENI Pyruvate carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04462 PE=4 SV=1
14	AFDB:Q9UUE1	0.921	0.916	0.000	1185	0.523	0.520	Q9UUE1.pdb.gz	PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pyr1 PE=3 SV=1
15	PDB:3ho8D	0.760	0.954	1.449E-100	934	0.391	0.494	3ho8D.pdb.gz	A Symmetrical Tetramer for S. aureus Pyruvate Carboxylase in Complex with Coenzyme A.
16	PDB:1dv2A	0.368	0.939	1.945E-47	450	0.166	0.436	1dv2A.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
17	PDB:5mlkA	0.364	0.934	4.574E-47	451	0.166	0.435	5mlkA.pdb.gz
18	PDB:3u9sA	0.348	0.638	1.100E-44	621	0.169	0.320	3u9sA.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
19	PDB:1dv1B	0.331	0.878	3.199E-43	428	0.154	0.425	1dv1B.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
20	PDB:3n6rG	0.348	0.613	1.447E-42	646	0.206	0.376	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0H3JRU9	0.0	1108	1150	0.473	0.484	PYC_STAAM Pyruvate carboxylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=pycA PE=1 SV=1
2	A0A0R4IFJ4	0.0	2020	1181	0.831	0.829	A0A0R4IFJ4_DANRE Pyruvate carboxylase OS=Danio rerio OX=7955 GN=PYCa PE=1 SV=1
3	F1QYZ6	0.0	2010	1181	0.828	0.826	F1QYZ6_DANRE Pyruvate carboxylase OS=Danio rerio OX=7955 GN=PYCb PE=1 SV=1
4	H2L2E4	0.0	843	616	0.334	0.638	H2L2E4_CAEEL Pyruvate carboxylase subunit B OS=Caenorhabditis elegans OX=6239 GN=pyc-1 PE=1 SV=1
5	O17732	0.0	1565	1175	0.638	0.639	PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans OX=6239 GN=pyc-1 PE=1 SV=1
6	P11154	0.0	1217	1178	0.528	0.528	PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PYC1 PE=1 SV=2
7	P11498	0.0	2432	1178	1.000	1.000	PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2
8	P32327	0.0	1222	1180	0.525	0.525	PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PYC2 PE=1 SV=2
9	P52873	0.0	2372	1178	0.963	0.963	PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pc PE=1 SV=2
10	P95127	0.0	953	1127	0.458	0.478	P95127_MYCTO Pyruvate carboxylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pca PE=4 SV=2
11	Q05920	0.0	2374	1178	0.967	0.967	PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1
12	Q0E9E2	0.0	1652	1197	0.675	0.664	Q0E9E2_DROME Pyruvate carboxylase OS=Drosophila melanogaster OX=7227 GN=PCB PE=1 SV=1
13	Q5B4R8	0.0	1229	1196	0.530	0.522	Q5B4R8_EMENI Pyruvate carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04462 PE=4 SV=1
14	Q7KN97	0.0	1659	1181	0.675	0.673	Q7KN97_DROME Pyruvate carboxylase OS=Drosophila melanogaster OX=7227 GN=PCB PE=1 SV=1
15	Q86NV1	0.0	1023	736	0.413	0.662	Q86NV1_DROME GH03002p (Fragment) OS=Drosophila melanogaster OX=7227 GN=PCB PE=2 SV=1
16	Q8JHF6	0.0	1866	1178	0.778	0.778	Q8JHF6_CHICK Pyruvate carboxylase OS=Gallus gallus OX=9031 GN=PYC PE=2 SV=1
17	Q9UUE1	0.0	1234	1185	0.530	0.527	PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pyr1 PE=3 SV=1
18	F4JYE0	3.26e-122	390	555	0.175	0.371	F4JYE0_ARATH Biotin carboxylase OS=Arabidopsis thaliana OX=3702 GN=CAC2 PE=1 SV=1
19	I3R7G3	3.17e-120	386	601	0.174	0.341	PCCA_HALMT Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) OX=523841 GN=pccA PE=1 SV=1
20	Q9HZV6	4.03e-119	385	661	0.175	0.312	Q9HZV6_PSEAE Geranyl-CoA carboxylase, alpha-subunit (Biotin-containing) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atuF PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02655 ATP-grasp_3	28	16.2	ATP-grasp domain
2	PF14398 ATPgrasp_YheCD	1.2e+02	13.4	YheC/D like ATP-grasp
3	PF02785 Biotin_carb_C	1.3e-30	117.1	Biotin carboxylase C-terminal domain
4	PF00289 Biotin_carb_N	2e-39	145.9	Biotin carboxylase, N-terminal domain
5	PF00364 Biotin_lipoyl	3.9e-14	63.5	Biotin-requiring enzyme
6	PF13533 Biotin_lipoyl_2	0.56	21.3	Biotin-lipoyl like
7	PF02786 CPSase_L_D2	4.6e-72	253.5	Carbamoyl-phosphate synthase L chain, ATP binding domain
8	PF07478 Dala_Dala_lig_C	1.3e-06	39.6	D-ala D-ala ligase C-terminus
9	PF16576 HlyD_D23	2e+02	12.6	Barrel-sandwich domain of CusB or HlyD membrane-fusion
10	PF00682 HMGL-like	3.9e-22	90.6	HMGL-like
11	PF00358 PTS_EIIA_1	9.3e+02	11.0	phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1
12	PF02436 PYC_OADA	3.9e-65	230.9	Conserved carboxylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382071	0.995	Biotin--protein ligase
2	9606.ENSP00000342056	0.986	Citrate synthase, mitochondrial
3	9606.ENSP00000327070	0.985	Malate dehydrogenase, mitochondrial
4	9606.ENSP00000216780	0.981	Phosphoenolpyruvate carboxykinase [GTP], mitochondrial
5	9606.ENSP00000319814	0.981	Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
6	9606.ENSP00000253792	0.975	ATP-citrate synthase
7	9606.ENSP00000320171	0.975	Pyruvate kinase PKM
8	9606.ENSP00000339933	0.975	Pyruvate kinase PKLR
9	9606.ENSP00000358719	0.967	Malic enzyme 1
10	9606.ENSP00000438144	0.967	Malate dehydrogenase, cytoplasmic
11	9606.ENSP00000307241	0.964	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
12	9606.ENSP00000440246	0.963	NADP-dependent malic enzyme, mitochondrial
13	9606.ENSP00000445175	0.963	Lactate dehydrogenase A
14	9606.ENSP00000321070	0.956	NAD-dependent malic enzyme, mitochondrial
15	9606.ENSP00000379386	0.950	Lactate dehydrogenase B
16	9606.ENSP00000245206	0.942	Aspartate aminotransferase, mitochondrial
17	9606.ENSP00000280706	0.939	L-lactate dehydrogenase A-like 6A
18	9606.ENSP00000302393	0.938	Lactate dehydrogenase A like 6B
19	9606.ENSP00000437783	0.938	L-lactate dehydrogenase C chain
20	9606.ENSP00000295266	0.932	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016885	0.998	ligase activity, forming carbon-carbon bonds
GO:0005488	0.997	binding
GO:0005515	0.993	protein binding
GO:0043167	0.891	ion binding
GO:0004736	0.838	pyruvate carboxylase activity
GO:0042802	0.833	identical protein binding
GO:0097159	0.681	organic cyclic compound binding
GO:1901363	0.638	heterocyclic compound binding
GO:0030554	0.563	adenyl nucleotide binding
GO:0031406	0.557	carboxylic acid binding
GO:0032559	0.536	adenyl ribonucleotide binding
GO:0035639	0.507	purine ribonucleoside triphosphate binding
GO:0033293	0.499	monocarboxylic acid binding
GO:0019842	0.497	vitamin binding
GO:1901681	0.482	sulfur compound binding
GO:0033218	0.463	amide binding
GO:0005524	0.453	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0006006	0.987	glucose metabolic process
GO:0019319	0.985	hexose biosynthetic process
GO:0006094	0.983	gluconeogenesis
GO:0044237	0.881	cellular metabolic process
GO:0006807	0.461	nitrogen compound metabolic process
GO:0065007	0.353	biological regulation
GO:1901564	0.352	organonitrogen compound metabolic process
GO:0050789	0.320	regulation of biological process
GO:0019752	0.317	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031974	0.987	membrane-enclosed lumen
GO:0070013	0.977	intracellular organelle lumen
GO:0005829	0.886	cytosol
GO:0005759	0.803	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.4.-.-	0.998	Forming carbon-carbon bonds.
RHEA:20844	0.838	ATP + hydrogencarbonate + pyruvate = ADP + H(+) + oxaloacetate + phosphate
EC:6.4.1.1	0.838	pyruvate carboxylase.

[back to server]