StarFunc result for job id P11532

User Input

>input (1400 residues)
MLWWEEVEDCYEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQ
KLPKEKGSTRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDL
FDWNSVVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLP
QQVSIEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYA
YTQAAYVTTSDPTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAED
TLQAQGEISNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEV
QEQMNLLNSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLG
PDLEDLKRQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRW
ANICRWTEDRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSL
QKLAVLKADLEKKKQSMGKLYSLKQDLLSTLKNKSVTQKTEAWLDNFARCWDNLVQKLEK
STAQISQAVTTTQPSLTQTTVMETVTTVTTREQILVKHAQEELPPPPPQKKRQITVDSEI
RKRLDVDITELHSWITRSEAVLQSPEFAIFRKEGNFSDLKEKVNAIEREKAEKFRKLQDA
SRSAQALVEQMVNEGVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIIAFYNQLQ
QLEQMTTTAENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSDLQPQIERLKIQSIALKEK
GQGPMFLDADFVAFTNHFKQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSET
KLSIPQLSVTDYEIMEQRLGELQALQSSLQEQQSGLYYLSTTVKEMSKKAPSEISRKYQS
EFEEIEGRWKKLSSQLVEHCQKLEEQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGD
SEILKKQLKQCRLLVSDIQTIQPSLNSVNEGGQKIKNEAEPEFASRLETELKELNTQWDH
MCQQVYARKEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEM
KRAKEEAQQKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKT
LEEVWACWHELLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLDSLENLMRHSEDNP
NQIRILAQTLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLH
LIQESLTFIDKQLAAYIADK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1W2P8A5	0.226	0.404	4.827E-56	732	0.296	0.567	A0A1W2P8A5.pdb.gz	A0A1W2P8A5_MOUSE Utrophin (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
2	AFDB:A0A0R4IF13	0.213	0.443	2.063E-50	583	0.265	0.636	A0A0R4IF13.pdb.gz
3	AFDB:O15020	0.155	0.092	4.171E-35	2390	0.193	0.113	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
4	AFDB:P11277	0.150	0.099	8.137E-35	2137	0.204	0.134	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
5	AFDB:F1QQE5	0.153	0.096	2.591E-34	2357	0.198	0.118	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
6	AFDB:Q01082	0.154	0.100	2.405E-33	2364	0.198	0.117	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
7	AFDB:E0AHA7	0.156	0.098	8.754E-33	2326	0.200	0.120	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
8	AFDB:Q00963	0.155	0.095	5.517E-31	2291	0.193	0.118	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
9	AFDB:Q9H254	0.184	0.116	1.607E-30	2564	0.205	0.112	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
10	AFDB:Q503P9	0.162	0.283	1.206E-22	786	0.139	0.247	Q503P9.pdb.gz
11	PDB:4d1eA	0.153	0.248	1.803E-15	859	0.112	0.183	4d1eA.pdb.gz
12	PDB:1sjjA	0.126	0.183	1.552E-13	863	0.121	0.197	1sjjA.pdb.gz
13	PDB:7sx8D	0.128	0.351	4.181E-6	448	0.043	0.134	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:7ktuA	0.055	0.069	3.055E-3	995	0.091	0.128	7ktuA.pdb.gz
15	PDB:4iggB	0.074	0.120	7.124E-3	771	0.064	0.115	4iggB.pdb.gz
16	PDB:1tr2B	0.064	0.079	8.514E-3	1029	0.082	0.112	1tr2B.pdb.gz
17	PDB:7ajuUT	0.059	0.048	1.017E-2	2313	0.111	0.067	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:7r5j00	0.055	0.089	1.899E-2	756	0.082	0.152	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:7t3uC	0.063	0.058	2.964E-2	1575	0.112	0.100	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:2xwuB	0.055	0.082	4.049E-2	910	0.075	0.115	2xwuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JW60	0.0	1162	3424	0.461	0.189	A0A0G2JW60_RAT Utrophin OS=Rattus norvegicus OX=10116 GN=Utrn PE=1 SV=1
2	A0A0R4IXX0	0.0	1677	3609	0.599	0.232	A0A0R4IXX0_DANRE Dystrophin OS=Danio rerio OX=7955 GN=Dp71 PE=1 SV=2
3	A0A1W2P8A5	0.0	741	732	0.296	0.567	A0A1W2P8A5_MOUSE Utrophin (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
4	A0A1W2P8G5	0.0	746	730	0.299	0.573	A0A1W2P8G5_MOUSE Utrophin (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
5	E9Q6R7	0.0	1130	3430	0.460	0.188	E9Q6R7_MOUSE Utrophin OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
6	G3V7L1	0.0	1162	3419	0.461	0.189	UTRN_RAT Utrophin OS=Rattus norvegicus OX=10116 GN=Utrn PE=1 SV=3
7	O08614	0.0	1113	3429	0.453	0.185	O08614_MOUSE Cytoskeletal protein OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
8	P11530	0.0	2568	3677	0.896	0.341	DMD_RAT Dystrophin OS=Rattus norvegicus OX=10116 GN=Dmd PE=1 SV=2
9	P11531	0.0	2536	3678	0.888	0.338	DMD_MOUSE Dystrophin OS=Mus musculus OX=10090 GN=Dmd PE=1 SV=3
10	P11532	0.0	2874	3685	1.000	0.380	DMD_HUMAN Dystrophin OS=Homo sapiens OX=9606 GN=DMD PE=1 SV=3
11	P46939	0.0	1191	3433	0.461	0.188	UTRN_HUMAN Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2
12	Q3TR59	0.0	738	718	0.295	0.575	Q3TR59_MOUSE Calponin-homology (CH) domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
13	Q3UYS4	0.0	743	727	0.296	0.571	Q3UYS4_MOUSE Calponin-homology (CH) domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
14	Q6P6L2	0.0	747	732	0.299	0.571	Q6P6L2_MOUSE Utrn protein (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
15	Q810I5	0.0	744	732	0.297	0.568	Q810I5_MOUSE Utrn protein (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
16	A0A1W2P6L4	7.79e-82	268	186	0.090	0.677	A0A1W2P6L4_MOUSE Utrophin (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
17	P11277	5.37e-65	246	2137	0.085	0.056	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
18	P15508	6.63e-65	246	2128	0.084	0.055	SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus OX=10090 GN=Sptb PE=1 SV=4
19	A0A140UHX6	1.10e-64	245	2117	0.084	0.056	A0A140UHX6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=2
20	Q6XDA0	1.29e-64	245	2137	0.084	0.055	Q6XDA0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	0.0037	28.3	CAMSAP CH domain
2	PF00307 CH	4e-40	147.7	Calponin homology (CH) domain
3	PF12867 DinB_2	1.4e+02	14.3	DinB superfamily
4	PF10279 Latarcin	0.55	22.0	Latarcin precursor
5	PF17107 SesA	6.1e+02	12.0	N-terminal domain on NACHT_NTPase and P-loop NTPases
6	PF00435 Spectrin	9.8e-94	320.2	Spectrin repeat
7	PF02346 Vac_Fusion	1.8e+02	13.2	Chordopoxvirus multifunctional envelope protein A27

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354923

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217381	0.999	Alpha-1-syntrophin
2	9606.ENSP00000442600	0.999	Dystroglycan
3	9606.ENSP00000262018	0.997	Alpha-sarcoglycan
4	9606.ENSP00000341940	0.997	Caveolin-3
5	9606.ENSP00000477999	0.997	Nitric oxide synthase, brain
6	9606.ENSP00000338343	0.994	Delta-sarcoglycan
7	9606.ENSP00000378965	0.994	Beta-1-syntrophin
8	9606.ENSP00000218867	0.993	Gamma-sarcoglycan
9	9606.ENSP00000368678	0.992	Agrin
10	9606.ENSP00000370839	0.990	Beta-sarcoglycan
11	9606.ENSP00000372654	0.989	Aquaporin-4
12	9606.ENSP00000320434	0.988	Alpha-catulin
13	9606.ENSP00000242729	0.987	Sarcospan
14	9606.ENSP00000410257	0.987	Sodium channel protein type 5 subunit alpha
15	9606.ENSP00000400365	0.986	Laminin subunit alpha-2
16	9606.ENSP00000458162	0.986	Actin, cytoplasmic 2
17	9606.ENSP00000311837	0.981	Gamma-2-syntrophin
18	9606.ENSP00000338191	0.975	Beta-2-syntrophin
19	9606.ENSP00000429842	0.972	Gamma-1-syntrophin
20	9606.ENSP00000355645	0.971	Actin, alpha skeletal muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.992	cytoskeletal protein binding
GO:0003779	0.967	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.935	biological regulation
GO:0050789	0.924	regulation of biological process
GO:0016043	0.900	cellular component organization
GO:0032502	0.893	developmental process
GO:0032501	0.835	multicellular organismal process
GO:0048856	0.734	anatomical structure development
GO:0061061	0.446	muscle structure development
GO:0050794	0.438	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.998	membrane
GO:0005886	0.994	plasma membrane
GO:0032991	0.978	protein-containing complex
GO:0043226	0.965	organelle
GO:0005737	0.955	cytoplasm
GO:0043228	0.953	non-membrane-bounded organelle
GO:0043229	0.916	intracellular organelle
GO:0043232	0.897	intracellular non-membrane-bounded organelle
GO:0042383	0.885	sarcolemma
GO:0090665	0.783	glycoprotein complex
GO:0016010	0.751	dystrophin-associated glycoprotein complex
GO:0099081	0.578	supramolecular polymer
GO:0099512	0.573	supramolecular fiber
GO:0120025	0.571	plasma membrane bounded cell projection
GO:0005856	0.536	cytoskeleton
GO:0030054	0.508	cell junction
GO:0045202	0.452	synapse
GO:0005829	0.440	cytosol
GO:0043292	0.409	contractile fiber
GO:0043227	0.333	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]