StarFunc result for job id P11717

User Input

>input (2491 residues)
MGAAAGRSPHLGPAPARRPQRSLLLLQLLLLVAAPGSTQAQAAPFPELCSYTWEAVDTKN
NVLYKINICGSVDIVQCGPSSAVCMHDLKTRTYHSVGDSVLRSATRSLLEFNTTVSCDQQ
GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEE
LRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGH
QAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSERREGTIPKL
TAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGSSYISDGKEYL
FYLNVCGETEIQFCNKKQAAVCQVKKSDTSQVKAAGRYHNQTLRYSDGDLTLIYFGGDEC
SSGFQRMSVINFECNKTAGNDGKGTPVFTGEVDCTYFFTWDTEYACVKEKEDLLCGATDG
KKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAV
DKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKTNITLVCKPGDLESAPVLRTS
GEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLTKKNGAYKVETKKYDFY
INVCGPVSVSPCQPDSGACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERH
TPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYDL
SSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGS
FTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTTRIHLVCSRGRLNS
HPIFSLNWECVVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNLNPLNSSQGYNVSG
IGKIFMFNVCGTMPVCGTILGKPASGCEAETQTEELKNWKPARPVGIEKSLQLSTEGFIT
LTYKGPLSAKGTADAFIVRFVCNDDVYSGPLKFLHQDIDSGQGIRNTYFEFETALACVPS
PVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVCNPLPYIPGCQGSAVG
SCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISGSPAFQ
LQDGCEYVFIWRTVEACPVVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFR
VCGKLSSDVCPTSDKSKVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCH
KVYQRSTAIFFYCDRGTQRPVFLKETSDCSYLFEWRTQYACPPFDLTECSFKDGAGNSFD
LSSLSRYSDNWEAITGTGDPEHYLINVCKSLAPQAGTEPCPPEAAACLLGGSKPVNLGRV
RDGPQWRDGIIVLKYVDGDLCPDGIRKKSTTIRFTCSESQVNSRPMFISAVEDCEYTFAW
PTATACPMKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCP
PGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEARP
TNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYDESE
DDASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEI
YLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVR
MDGCTLTDEQLLYSFNLSSLSTSTFKVTRDSRTYSVGVCTFAVGPEQGGCKDGGVCLLSG
TKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPETDDGVPCVFPFIFNGKSYEECIIE
SRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKCDEDEDIGRPQVFSEVRGCDVTFE
WKTKVVCPPKKLECKFVQKHKTYDLRLLSSLTGSWSLVHNGVSYYINLCQKIYKGPLGCS
ERASICRRTTTGDVQVLGLVHTQKLGVIGDKVVVTYSKGYPCGGNKTASSVIELTCTKTV
GRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKLFRA
SGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDG
DLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPL
GVGFDSENPGDDGQMHKGLSERSQAVGAVLSLLLVALTCCLLALLLYKKERRETVISKLT
TCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPPPRQGKEGQENGHITTKSVKALS
SLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNAQSNALQEREDDRVGLVRGEKAR
KGKSSSAQQKTVSSTKLVSFHDDSDEDLLHI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11717	1.000	1.000	0.000	2491	1.000	1.000	P11717.pdb.gz	MPRI_HUMAN Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3
2	PDB:6urgA	0.042	0.067	2.154E-6	1202	0.048	0.100	6urgA.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
3	PDB:7uknA	0.047	0.089	3.211E-6	1059	0.051	0.121	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
4	AFDB:O70535	0.033	0.058	5.948E-5	1093	0.051	0.115	O70535.pdb.gz	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
5	AFDB:Q5A8T4	0.036	0.052	6.908E-5	1260	0.073	0.145	Q5A8T4.pdb.gz	ALS1_CANAL Agglutinin-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALS1 PE=1 SV=1
6	PDB:6r8yK	0.048	0.116	7.452E-5	825	0.038	0.115	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
7	PDB:5lqwX	0.039	0.057	9.098E-5	1095	0.047	0.106	5lqwX.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
8	PDB:1gxdA	0.024	0.078	1.426E-4	624	0.022	0.090	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
9	AFDB:Q9W213	0.039	0.052	2.071E-4	1395	0.049	0.087	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
10	PDB:7lpsA	0.054	0.117	2.728E-4	781	0.029	0.093	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
11	AFDB:P98163	0.044	0.048	3.088E-4	1984	0.079	0.100	P98163.pdb.gz	YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster OX=7227 GN=yl PE=1 SV=2
12	PDB:7mq8LN	0.053	0.117	3.501E-4	671	0.033	0.121	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:O88689	0.026	0.046	5.087E-4	947	0.042	0.111	O88689.pdb.gz	PCDA4_MOUSE Protocadherin alpha-4 OS=Mus musculus OX=10090 GN=Pcdha4 PE=1 SV=1
14	AFDB:Q99062	0.032	0.058	5.087E-4	836	0.042	0.124	Q99062.pdb.gz	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
15	AFDB:Q7TQF1	0.025	0.050	5.347E-4	918	0.039	0.105	Q7TQF1.pdb.gz	Q7TQF1_MOUSE Protocadherin gamma subfamily B, 1 OS=Mus musculus OX=10090 GN=Pcdhgb1 PE=2 SV=1
16	AFDB:P01132	0.044	0.067	7.972E-4	1217	0.058	0.118	P01132.pdb.gz	EGF_MOUSE Pro-epidermal growth factor OS=Mus musculus OX=10090 GN=Egf PE=1 SV=2
17	AFDB:F1QRP2	0.033	0.050	8.809E-4	1135	0.050	0.110	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
18	PDB:6lqsB1	0.039	0.075	1.282E-3	806	0.026	0.079	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
19	PDB:5juyB	0.038	0.059	2.009E-3	1234	0.028	0.057	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
20	PDB:7jptA	0.027	0.045	5.730E-3	1327	0.022	0.041	7jptA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AI55	0.0	4135	2439	0.798	0.815	A0A8I6AI55_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
2	A0A8I6GLL6	0.0	4138	2479	0.801	0.805	A0A8I6GLL6_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
3	F1MIE6	0.0	4163	2499	0.810	0.808	F1MIE6_BOVIN Insulin like growth factor 2 receptor OS=Bos taurus OX=9913 GN=IGF2R PE=4 SV=3
4	G3V824	0.0	4137	2481	0.799	0.802	G3V824_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
5	P08169	0.0	4163	2499	0.810	0.808	MPRI_BOVIN Cation-independent mannose-6-phosphate receptor OS=Bos taurus OX=9913 GN=IGF2R PE=1 SV=2
6	P11717	0.0	5175	2491	1.000	1.000	MPRI_HUMAN Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3
7	Q07113	0.0	4208	2483	0.813	0.816	MPRI_MOUSE Cation-independent mannose-6-phosphate receptor OS=Mus musculus OX=10090 GN=Igf2r PE=1 SV=1
8	Q8IMR1	8.69e-42	170	887	0.073	0.204	Q8IMR1_DROME LD05154p OS=Drosophila melanogaster OX=7227 GN=Lerp PE=1 SV=2
9	Q8IMR0	1.19e-41	170	886	0.073	0.204	Q8IMR0_DROME Lysosomal enzyme receptor protein OS=Drosophila melanogaster OX=7227 GN=Lerp PE=1 SV=2
10	B7Z0Q8	1.23e-41	170	917	0.073	0.197	B7Z0Q8_DROME Lysosomal enzyme receptor protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Lerp PE=1 SV=1
11	A0A0B4KH68	1.41e-41	169	918	0.073	0.197	A0A0B4KH68_DROME Lysosomal enzyme receptor protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Lerp PE=1 SV=1
12	Q95M44	2.95e-22	94.0	48	0.017	0.875	Q95M44_BOVIN Insulin-like growth factor receptor type 2 (Fragment) OS=Bos taurus OX=9913 PE=2 SV=1
13	B5X4C7	1.14e-08	63.2	671	0.010	0.039	B5X4C7_SALSA Matrix metalloproteinase-9 OS=Salmo salar OX=8030 GN=MMP9 PE=2 SV=1
14	P08253	1.32e-08	62.8	660	0.010	0.039	MMP2_HUMAN 72 kDa type IV collagenase OS=Homo sapiens OX=9606 GN=MMP2 PE=1 SV=2
15	A2CEW3	4.29e-08	61.6	2500	0.010	0.010	A2CEW3_DANRE Fibronectin OS=Danio rerio OX=7955 GN=cb1057 PE=1 SV=2
16	Q6JAN2	4.31e-08	61.6	2408	0.010	0.011	Q6JAN2_DANRE Fibronectin OS=Danio rerio OX=7955 GN=wu:fb03c02 PE=1 SV=1
17	P50282	5.52e-08	60.8	708	0.011	0.038	MMP9_RAT Matrix metalloproteinase-9 OS=Rattus norvegicus OX=10116 GN=Mmp9 PE=2 SV=1
18	Q9UBV2	5.80e-08	60.8	794	0.010	0.031	SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3
19	Q9Z2G6	5.98e-08	60.8	790	0.010	0.032	SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus OX=10090 GN=Sel1l PE=1 SV=2
20	Q13018	6.94e-08	60.8	1463	0.020	0.033	PLA2R_HUMAN Secretory phospholipase A2 receptor OS=Homo sapiens OX=9606 GN=PLA2R1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09451 ATG27	8.6e-55	198.0	Autophagy-related protein 27
2	PF00878 CIMR	0	1307.3	Cation-independent mannose-6-phosphate receptor repeat
3	PF00040 fn2	9e-14	62.6	Fibronectin type II domain
4	PF18564 Glyco_hydro_5_C	4.9e+02	12.7	Glycoside hydrolase family 5 C-terminal domain
5	PF02157 Man-6-P_recep	6.1e-25	99.3	Mannose-6-phosphate receptor
6	PF13015 PRKCSH_1	0.0029	28.8	Glucosidase II beta subunit-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349437

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341344	0.999	ADP-ribosylation factor-binding protein GGA1
2	9606.ENSP00000391826	0.999	Insulin-like growth factor II
3	9606.ENSP00000311962	0.998	ADP-ribosylation factor-binding protein GGA2
4	9606.ENSP00000438085	0.997	ADP-ribosylation factor-binding protein GGA3
5	9606.ENSP00000366998	0.987	Sorting nexin-5
6	9606.ENSP00000377148	0.985	AP-1 complex subunit gamma-1
7	9606.ENSP00000339328	0.983	Urokinase plasminogen activator surface receptor
8	9606.ENSP00000299138	0.982	Vacuolar protein sorting-associated protein 35
9	9606.ENSP00000302665	0.982	Insulin-like growth factor I
10	9606.ENSP00000261842	0.981	AP-4 complex subunit epsilon-1
11	9606.ENSP00000000412	0.979	Cation-dependent mannose-6-phosphate receptor
12	9606.ENSP00000359540	0.979	Protein CREG1
13	9606.ENSP00000236671	0.978	Cathepsin D
14	9606.ENSP00000221957	0.977	Perilipin-3
15	9606.ENSP00000368831	0.969	Sorting nexin-2
16	9606.ENSP00000353731	0.968	Dipeptidyl peptidase 4
17	9606.ENSP00000256637	0.964	Sortilin
18	9606.ENSP00000362480	0.959	Vacuolar protein sorting-associated protein 26A
19	9606.ENSP00000225719	0.950	M14 carboxypeptidases
20	9606.ENSP00000268035	0.944	Insulin-like growth factor 1 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036094	1.000	small molecule binding
GO:0005520	1.000	insulin-like growth factor binding
GO:0004714	0.999	transmembrane receptor protein tyrosine kinase activity
GO:0043168	0.998	anion binding
GO:0008289	0.996	lipid binding
GO:0019899	0.996	enzyme binding
GO:0044877	0.992	protein-containing complex binding
GO:0001972	0.992	retinoic acid binding
GO:0001965	0.991	G-protein alpha-subunit binding
GO:0031995	0.991	insulin-like growth factor II binding
GO:0005010	0.969	insulin-like growth factor receptor activity
GO:0051219	0.923	phosphoprotein binding
GO:0042802	0.920	identical protein binding
GO:0048029	0.595	monosaccharide binding
GO:1905394	0.577	retromer complex binding
GO:0005537	0.568	mannose binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0006810	0.992	transport
GO:0023052	0.988	signaling
GO:0007154	0.986	cell communication
GO:0051716	0.986	cellular response to stimulus
GO:0048518	0.976	positive regulation of biological process
GO:0033036	0.970	macromolecule localization
GO:0051641	0.970	cellular localization
GO:0007165	0.932	signal transduction
GO:0048522	0.929	positive regulation of cellular process
GO:0032501	0.922	multicellular organismal process
GO:0032502	0.914	developmental process
GO:0070727	0.911	cellular macromolecule localization
GO:0008104	0.842	protein localization
GO:0048856	0.824	anatomical structure development
GO:0016192	0.818	vesicle-mediated transport
GO:0006897	0.798	endocytosis
GO:0071702	0.779	organic substance transport
GO:0010941	0.771	regulation of cell death
GO:0015031	0.770	protein transport
GO:0051702	0.724	biological process involved in interaction with symbiont
GO:0043067	0.716	regulation of programmed cell death
GO:0007186	0.713	G protein-coupled receptor signaling pathway
GO:0000003	0.706	reproduction
GO:0042221	0.706	response to chemical
GO:0006898	0.703	receptor-mediated endocytosis
GO:0022414	0.655	reproductive process
GO:0019953	0.640	sexual reproduction
GO:0051851	0.638	modulation by host of symbiont process
GO:0007276	0.617	gamete generation
GO:0043065	0.587	positive regulation of apoptotic process
GO:0007275	0.571	multicellular organism development
GO:0048232	0.537	male gamete generation
GO:0007283	0.533	spermatogenesis
GO:0010033	0.531	response to organic substance
GO:0048513	0.527	animal organ development
GO:0044788	0.516	modulation by host of viral process
GO:0061008	0.466	hepaticobiliary system development
GO:1901700	0.434	response to oxygen-containing compound
GO:0048732	0.428	gland development
GO:0051649	0.410	establishment of localization in cell
GO:0033993	0.399	response to lipid
GO:0031099	0.396	regeneration
GO:0009791	0.379	post-embryonic development
GO:0032526	0.367	response to retinoic acid
GO:0046907	0.339	intracellular transport
GO:0001889	0.330	liver development
GO:0031100	0.321	animal organ regeneration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005794	0.999	Golgi apparatus
GO:0032991	0.997	protein-containing complex
GO:0005576	0.970	extracellular region
GO:0031982	0.948	vesicle
GO:0031410	0.926	cytoplasmic vesicle
GO:0005768	0.918	endosome
GO:0098796	0.898	membrane protein complex
GO:0005615	0.893	extracellular space
GO:0031984	0.887	organelle subcompartment
GO:0005802	0.845	trans-Golgi network
GO:0031974	0.776	membrane-enclosed lumen
GO:0070013	0.760	intracellular organelle lumen
GO:0031090	0.709	organelle membrane
GO:0048471	0.609	perinuclear region of cytoplasm
GO:0005634	0.594	nucleus
GO:0005770	0.557	late endosome
GO:0030659	0.550	cytoplasmic vesicle membrane
GO:0070062	0.545	extracellular exosome
GO:0030117	0.508	membrane coat
GO:0098588	0.489	bounding membrane of organelle
GO:0030135	0.430	coated vesicle
GO:0030136	0.396	clathrin-coated vesicle
GO:0010008	0.387	endosome membrane
GO:0030666	0.383	endocytic vesicle membrane
GO:0030665	0.380	clathrin-coated vesicle membrane
GO:0005829	0.379	cytosol
GO:0030141	0.378	secretory granule
GO:0005769	0.355	early endosome
GO:0009986	0.346	cell surface
GO:0030133	0.346	transport vesicle
GO:0045334	0.342	clathrin-coated endocytic vesicle
GO:0030140	0.339	trans-Golgi network transport vesicle
GO:0030118	0.334	clathrin coat
GO:0030669	0.330	clathrin-coated endocytic vesicle membrane
GO:0030667	0.327	secretory granule membrane
GO:0031981	0.326	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.999	receptor protein-tyrosine kinase.

[back to server]