StarFunc result for job id P11802

User Input

>input (303 residues)
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBB6	0.913	0.913	6.983E-54	303	1.000	1.000	A0A024RBB6.pdb.gz
2	AFDB:Q91727	0.953	0.905	1.775E-47	319	0.752	0.715	Q91727.pdb.gz	CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis OX=8355 GN=cdk4 PE=1 SV=1
3	AFDB:F1MA87	0.949	0.882	1.137E-44	326	0.686	0.638	F1MA87.pdb.gz	F1MA87_RAT Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=2
4	PDB:2w96B	0.850	0.962	1.823E-42	267	0.868	0.985	2w96B.pdb.gz
5	PDB:2w99B	0.918	0.955	6.495E-42	291	0.947	0.986	2w99B.pdb.gz
6	PDB:1blxA	0.911	0.905	4.568E-40	305	0.696	0.692	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
7	AFDB:E7F5L4	0.913	0.907	9.193E-35	305	0.515	0.511	E7F5L4.pdb.gz	E7F5L4_DANRE Cyclin-dependent kinase 21 OS=Danio rerio OX=7955 GN=cdk21 PE=3 SV=1
8	PDB:1bi7A	0.773	0.866	5.863E-32	269	0.640	0.721	1bi7A.pdb.gz
9	AFDB:Q7K306	0.885	0.847	2.923E-31	317	0.459	0.438	Q7K306.pdb.gz	Q7K306_DROME Cyclin-dependent kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdk4 PE=2 SV=1
10	AFDB:P43063	0.882	0.844	3.775E-29	317	0.432	0.413	P43063.pdb.gz	CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC28 PE=1 SV=1
11	AFDB:Q9XTR1	0.872	0.659	1.345E-28	406	0.396	0.296	Q9XTR1.pdb.gz	CDK4_CAEEL Cyclin-dependent kinase 4 homolog OS=Caenorhabditis elegans OX=6239 GN=cdk-4 PE=1 SV=2
12	PDB:4tthB	0.755	0.888	2.597E-28	256	0.617	0.730	4tthB.pdb.gz	Discovery of AMG 925, a FLT3 and CDK4 dual kinase inhibitor with preferential affinity for the activated state of FLT3.
13	AFDB:P24100	0.861	0.886	2.914E-28	294	0.436	0.449	P24100.pdb.gz	CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana OX=3702 GN=CDKA-1 PE=1 SV=1
14	AFDB:P04551	0.855	0.872	4.791E-28	297	0.429	0.438	P04551.pdb.gz	CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc2 PE=1 SV=1
15	AFDB:P24033	0.872	0.875	8.797E-28	302	0.413	0.414	P24033.pdb.gz	CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis OX=8355 GN=cdk1-b PE=1 SV=2
16	PDB:4ek6A	0.814	0.881	1.728E-26	279	0.416	0.452	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
17	PDB:4yc3A	0.820	0.842	2.842E-26	295	0.403	0.414	4yc3A.pdb.gz
18	PDB:4gcjA	0.834	0.832	4.098E-24	304	0.439	0.438	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
19	PDB:1unlA	0.751	0.778	4.331E-24	292	0.419	0.435	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4eomC	0.747	0.816	1.237E-23	276	0.416	0.457	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11802	0.0	624	303	1.000	1.000	CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2
2	P30285	0.0	598	303	0.947	0.947	CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus OX=10090 GN=Cdk4 PE=1 SV=1
3	P35426	0.0	598	303	0.950	0.950	CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus OX=10116 GN=Cdk4 PE=1 SV=1
4	P79432	0.0	612	303	0.980	0.980	CDK4_PIG Cyclin-dependent kinase 4 OS=Sus scrofa OX=9823 GN=CDK4 PE=3 SV=1
5	Q91727	3.61e-168	471	319	0.749	0.712	CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis OX=8355 GN=cdk4 PE=1 SV=1
6	Q00534	4.91e-152	430	326	0.696	0.647	CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1
7	Q64261	1.48e-151	429	326	0.690	0.641	CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus OX=10090 GN=Cdk6 PE=1 SV=2
8	F1MA87	2.27e-151	429	326	0.690	0.641	F1MA87_RAT Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=2
9	A0A8I6A5X3	9.57e-141	401	306	0.640	0.634	A0A8I6A5X3_RAT Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=1
10	E7F5L4	4.55e-103	305	305	0.531	0.528	E7F5L4_DANRE Cyclin-dependent kinase 21 OS=Danio rerio OX=7955 GN=cdk21 PE=3 SV=1
11	Q7K306	1.70e-95	286	317	0.459	0.438	Q7K306_DROME Cyclin-dependent kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdk4 PE=2 SV=1
12	Q94877	5.62e-95	285	317	0.455	0.435	Q94877_DROME CDK4/6 kinase OS=Drosophila melanogaster OX=7227 GN=Cdk4 PE=2 SV=1
13	Q00526	1.25e-86	263	305	0.452	0.449	CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens OX=9606 GN=CDK3 PE=1 SV=1
14	P34117	6.80e-81	248	292	0.432	0.449	CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum OX=44689 GN=cdk5 PE=2 SV=2
15	P24100	7.41e-81	248	294	0.449	0.463	CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana OX=3702 GN=CDKA-1 PE=1 SV=1
16	Q63699	1.74e-80	247	298	0.442	0.450	CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus OX=10116 GN=Cdk2 PE=1 SV=1
17	P24941	1.78e-80	247	298	0.442	0.450	CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2 PE=1 SV=2
18	O55076	3.34e-80	247	298	0.439	0.446	CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus OX=10029 GN=CDK2 PE=1 SV=1
19	P23437	4.89e-80	246	297	0.432	0.441	CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis OX=8355 GN=cdk2 PE=1 SV=3
20	P29618	1.67e-79	245	294	0.436	0.449	CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica OX=39947 GN=CDKA-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	10	16.7	ABC1 atypical kinase-like domain
2	PF01636 APH	0.00012	33.5	Phosphotransferase enzyme family
3	PF13095 FTA2	5.5e+02	11.6	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	11	16.5	Haspin like kinase domain
5	PF06293 Kdo	1.2	20.1	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	2.7e+02	12.3	Kinase-like
7	PF00069 Pkinase	4.1e-61	218.3	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	2.7e-26	104.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257904

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227507	0.999	G1/S-specific cyclin-D1
2	9606.ENSP00000228872	0.999	Cyclin-dependent kinase inhibitor 1B
3	9606.ENSP00000261254	0.999	G1/S-specific cyclin-D2
4	9606.ENSP00000262662	0.999	Cyclin-dependent kinase 4 inhibitor C
5	9606.ENSP00000267163	0.999	Retinoblastoma-associated protein
6	9606.ENSP00000276925	0.999	Cyclin-dependent kinase 4 inhibitor B
7	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
8	9606.ENSP00000362082	0.999	G1/S-specific cyclin-D3
9	9606.ENSP00000368458	0.999	Proliferating cell nuclear antigen
10	9606.ENSP00000377224	0.999	Cyclin-dependent kinase 4 inhibitor D
11	9606.ENSP00000384849	0.999	Cyclin-dependent kinase inhibitor 1
12	9606.ENSP00000418915	0.999	Cyclin-dependent kinase inhibitor 2A
13	9606.ENSP00000222005	0.998	Hsp90 co-chaperone Cdc37
14	9606.ENSP00000274026	0.997	Cyclin-A2
15	9606.ENSP00000262643	0.995	G1/S-specific cyclin-E1
16	9606.ENSP00000256442	0.992	G2/mitotic-specific cyclin-B1
17	9606.ENSP00000362768	0.992	Retinoblastoma-like protein 1
18	9606.ENSP00000217958	0.991	26S proteasome non-ATPase regulatory subunit 10
19	9606.ENSP00000427514	0.990	CCAAT/enhancer-binding protein alpha
20	9606.ENSP00000262904	0.987	Transcription factor E2F3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030332	1.000	cyclin binding
GO:0004693	1.000	cyclin-dependent protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.983	response to stimulus
GO:0008152	0.900	metabolic process
GO:0048518	0.896	positive regulation of biological process
GO:0071704	0.893	organic substance metabolic process
GO:0044238	0.890	primary metabolic process
GO:0006807	0.880	nitrogen compound metabolic process
GO:0080090	0.878	regulation of primary metabolic process
GO:0044237	0.868	cellular metabolic process
GO:0043170	0.863	macromolecule metabolic process
GO:0051171	0.863	regulation of nitrogen compound metabolic process
GO:0031323	0.862	regulation of cellular metabolic process
GO:0060255	0.861	regulation of macromolecule metabolic process
GO:0048522	0.769	positive regulation of cellular process
GO:0051716	0.705	cellular response to stimulus
GO:1901564	0.671	organonitrogen compound metabolic process
GO:0048519	0.631	negative regulation of biological process
GO:0048523	0.581	negative regulation of cellular process
GO:0009889	0.545	regulation of biosynthetic process
GO:0043412	0.543	macromolecule modification
GO:0009893	0.542	positive regulation of metabolic process
GO:0019219	0.490	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.487	regulation of gene expression
GO:0010556	0.476	regulation of macromolecule biosynthetic process
GO:0031326	0.473	regulation of cellular biosynthetic process
GO:0051252	0.467	regulation of RNA metabolic process
GO:0019538	0.464	protein metabolic process
GO:0006355	0.459	regulation of DNA-templated transcription
GO:0010604	0.449	positive regulation of macromolecule metabolic process
GO:0007154	0.445	cell communication
GO:0023052	0.441	signaling
GO:0042127	0.429	regulation of cell population proliferation
GO:0032502	0.426	developmental process
GO:0007165	0.418	signal transduction
GO:0051173	0.402	positive regulation of nitrogen compound metabolic process
GO:0006950	0.401	response to stress
GO:0036211	0.401	protein modification process
GO:0048583	0.398	regulation of response to stimulus
GO:0031325	0.394	positive regulation of cellular metabolic process
GO:0016310	0.375	phosphorylation
GO:0051246	0.370	regulation of protein metabolic process
GO:0009892	0.351	negative regulation of metabolic process
GO:0051726	0.329	regulation of cell cycle
GO:0042221	0.309	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.989	nuclear lumen
GO:0005654	0.974	nucleoplasm
GO:0005829	0.918	cytosol
GO:0032991	0.737	protein-containing complex
GO:0043232	0.635	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.22	1.000	cyclin-dependent kinase.

[back to server]