StarFunc result for job id P11831

User Input

>input (508 residues)
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11831	0.999	0.999	2.130E-69	508	1.000	1.000	P11831.pdb.gz	SRF_HUMAN Serum response factor OS=Homo sapiens OX=9606 GN=SRF PE=1 SV=1
2	AFDB:F1LYX9	0.072	0.043	1.096E-4	1128	0.177	0.080	F1LYX9.pdb.gz	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
3	AFDB:Q14126	0.073	0.039	3.712E-4	1118	0.146	0.066	Q14126.pdb.gz	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
4	AFDB:A4L7N3	0.060	0.049	2.161E-3	662	0.181	0.139	A4L7N3.pdb.gz	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
5	AFDB:Q6DCP4	0.062	0.060	3.033E-3	647	0.169	0.133	Q6DCP4.pdb.gz	Q6DCP4_XENLA Nup98 protein (Fragment) OS=Xenopus laevis OX=8355 GN=Nup98 PE=2 SV=1
6	AFDB:Q93Z00	0.071	0.073	4.554E-3	489	0.154	0.160	Q93Z00.pdb.gz	TCP14_ARATH Transcription factor TCP14 OS=Arabidopsis thaliana OX=3702 GN=TCP14 PE=1 SV=1
7	AFDB:Q57XD0	0.072	0.069	4.873E-3	545	0.152	0.141	Q57XD0.pdb.gz	Q57XD0_TRYB2 LYT1p OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.580 PE=4 SV=1
8	AFDB:P54253	0.070	0.046	6.390E-3	815	0.177	0.110	P54253.pdb.gz	ATX1_HUMAN Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2
9	AFDB:Q8L8A8	0.064	0.062	1.027E-2	535	0.165	0.157	Q8L8A8.pdb.gz	GRF2_ARATH Growth-regulating factor 2 OS=Arabidopsis thaliana OX=3702 GN=GRF2 PE=1 SV=1
10	AFDB:Q8VIH1	0.086	0.083	1.027E-2	527	0.165	0.159	Q8VIH1.pdb.gz	NOBOX_MOUSE Homeobox protein NOBOX OS=Mus musculus OX=10090 GN=Nobox PE=1 SV=1
11	PDB:7r5jK0	0.043	0.023	8.028E-1	1086	0.018	0.008	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:3zqqC	0.048	0.126	8.591E-1	134	0.018	0.067	3zqqC.pdb.gz
13	PDB:4xo1A	0.066	0.437	8.591E-1	60	0.016	0.133	4xo1A.pdb.gz
14	PDB:6yxxAf	0.049	0.116	1.053	139	0.037	0.137	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
15	PDB:3zqjF	0.038	0.034	1.206	607	0.014	0.012	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
16	PDB:4wmqA	0.037	0.059	1.290	283	0.010	0.018	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:7myjD	0.049	0.097	1.290	187	0.020	0.053	7myjD.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
18	PDB:6gwjD	0.058	0.341	1.381	48	0.012	0.125	6gwjD.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
19	PDB:3o2gA	0.041	0.051	1.692	386	0.012	0.016	3o2gA.pdb.gz	Structural and mechanistic studies on gamma-butyrobetaine hydroxylase.
20	PDB:7qa8B	0.043	0.065	1.692	299	0.024	0.040	7qa8B.pdb.gz	Activation mechanism of the class D fungal GPCR dimer Ste2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZHH8	0.0	968	504	0.967	0.974	D3ZHH8_RAT Serum response factor OS=Rattus norvegicus OX=10116 GN=Srf PE=1 SV=2
2	P11831	0.0	1004	508	1.000	1.000	SRF_HUMAN Serum response factor OS=Homo sapiens OX=9606 GN=SRF PE=1 SV=1
3	Q9JM73	0.0	965	504	0.965	0.972	SRF_MOUSE Serum response factor OS=Mus musculus OX=10090 GN=Srf PE=1 SV=1
4	A8HAM3	3.80e-154	452	539	0.569	0.536	A8HAM3_DANRE Serum response factor a OS=Danio rerio OX=7955 GN=srf PE=4 SV=1
5	Q24535	7.26e-63	213	449	0.222	0.252	SRF_DROME Serum response factor homolog OS=Drosophila melanogaster OX=7227 GN=bs PE=1 SV=2
6	Q18955	1.62e-46	166	327	0.161	0.251	SRF_CAEEL Serum response factor homolog OS=Caenorhabditis elegans OX=6239 GN=unc-120 PE=2 SV=1
7	Q54TY7	8.42e-39	148	418	0.140	0.170	SRFA_DICDI Serum response factor homolog A OS=Dictyostelium discoideum OX=44689 GN=srfA PE=1 SV=1
8	Q54RY6	9.91e-37	143	467	0.134	0.146	SRFB_DICDI Serum response factor homolog B OS=Dictyostelium discoideum OX=44689 GN=srfB PE=3 SV=1
9	Q5AFP3	5.09e-32	125	262	0.118	0.229	MCM1_CANAL Transcription factor of morphogenesis MCM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MCM1 PE=1 SV=1
10	P11746	1.10e-30	122	286	0.106	0.189	MCM1_YEAST Pheromone receptor transcription factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCM1 PE=1 SV=2
11	P07249	7.79e-26	105	177	0.091	0.260	ARGR1_YEAST Arginine metabolism regulation protein I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG80 PE=1 SV=2
12	P78926	2.31e-13	73.9	398	0.067	0.085	PMAP1_SCHPO Pheromone receptor transcription activator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=map1 PE=4 SV=1
13	Q6EU39	1.10e-11	67.4	250	0.067	0.136	MADS6_ORYSJ MADS-box transcription factor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=MADS6 PE=1 SV=1
14	Q6EUV7	3.43e-11	65.9	247	0.073	0.150	Q6EUV7_GERHY MADS domain protein OS=Gerbera hybrida OX=18101 GN=grcd2 PE=1 SV=1
15	Q0JAS4	5.30e-11	65.1	254	0.057	0.114	Q0JAS4_ORYSJ MADS17 OS=Oryza sativa subsp. japonica OX=39947 GN=MADS17 PE=2 SV=1
16	Q7XUN2	5.31e-11	65.1	249	0.057	0.116	MAD17_ORYSJ MADS-box transcription factor 17 OS=Oryza sativa subsp. japonica OX=39947 GN=MADS17 PE=1 SV=2
17	P29386	5.52e-11	65.1	252	0.069	0.139	AGL6_ARATH Agamous-like MADS-box protein AGL6 OS=Arabidopsis thaliana OX=3702 GN=AGL6 PE=1 SV=2
18	Q1PEU3	5.52e-11	65.1	252	0.069	0.139	Q1PEU3_ARATH AGAMOUS-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=AGL6 PE=1 SV=1
19	D2T2F9	6.00e-11	65.1	252	0.055	0.111	D2T2F9_GERHY GRCD5 protein OS=Gerbera hybrida OX=18101 GN=grcd5 PE=1 SV=1
20	P29383	6.11e-11	65.1	258	0.051	0.101	AGL3_ARATH Agamous-like MADS-box protein AGL3 OS=Arabidopsis thaliana OX=3702 GN=AGL3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00319 SRF-TF	3.1e-16	69.9	SRF-type transcription factor (DNA-binding and dimerisation domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265354

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347847	0.999	MKL/myocardin-like protein 1
2	9606.ENSP00000401678	0.999	Myocardin
3	9606.ENSP00000350681	0.995	ETS domain-containing protein Elk-4
4	9606.ENSP00000339004	0.993	Forkhead box protein G1
5	9606.ENSP00000334458	0.992	Transcription factor GATA-4
6	9606.ENSP00000327758	0.989	Homeobox protein Nkx-2.5
7	9606.ENSP00000483056	0.987	ETS domain-containing protein Elk-1
8	9606.ENSP00000264606	0.978	Histone deacetylase 4
9	9606.ENSP00000450527	0.972	Homeodomain-only protein
10	9606.ENSP00000306245	0.971	Proto-oncogene c-Fos
11	9606.ENSP00000339086	0.969	MKL/myocardin-like protein 2
12	9606.ENSP00000239938	0.960	Early growth response protein 1
13	9606.ENSP00000217244	0.952	Casein kinase II subunit alpha
14	9606.ENSP00000229795	0.950	Mitogen-activated protein kinase 14
15	9606.ENSP00000379350	0.949	Integrin beta-1
16	9606.ENSP00000333685	0.944	Mitogen-activated protein kinase 11
17	9606.ENSP00000435412	0.939	Ribosomal protein S6 kinase alpha-1
18	9606.ENSP00000242480	0.937	E3 SUMO-protein ligase EGR2
19	9606.ENSP00000356070	0.934	MAP kinase-activated protein kinase 2
20	9606.ENSP00000368884	0.928	Ribosomal protein S6 kinase alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.998	DNA-binding transcription factor binding
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0046983	0.958	protein dimerization activity
GO:0042802	0.939	identical protein binding
GO:0042803	0.915	protein homodimerization activity
GO:0042826	0.683	histone deacetylase binding
GO:0010736	0.599	serum response element binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0031325	0.987	positive regulation of cellular metabolic process
GO:0051173	0.986	positive regulation of nitrogen compound metabolic process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0009987	0.984	cellular process
GO:0045935	0.982	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0050896	0.971	response to stimulus
GO:0048519	0.969	negative regulation of biological process
GO:1903508	0.966	positive regulation of nucleic acid-templated transcription
GO:0045893	0.960	positive regulation of DNA-templated transcription
GO:0032501	0.958	multicellular organismal process
GO:0006357	0.923	regulation of transcription by RNA polymerase II
GO:0045944	0.906	positive regulation of transcription by RNA polymerase II
GO:0051716	0.897	cellular response to stimulus
GO:0048856	0.892	anatomical structure development
GO:0006950	0.877	response to stress
GO:0008152	0.866	metabolic process
GO:0044237	0.839	cellular metabolic process
GO:0048523	0.797	negative regulation of cellular process
GO:0007275	0.787	multicellular organism development
GO:0051239	0.765	regulation of multicellular organismal process
GO:0042221	0.738	response to chemical
GO:0050793	0.737	regulation of developmental process
GO:0048731	0.684	system development
GO:0045595	0.679	regulation of cell differentiation
GO:0048513	0.664	animal organ development
GO:0071704	0.559	organic substance metabolic process
GO:0044238	0.555	primary metabolic process
GO:0006807	0.494	nitrogen compound metabolic process
GO:0009653	0.448	anatomical structure morphogenesis
GO:0009892	0.438	negative regulation of metabolic process
GO:0030154	0.431	cell differentiation
GO:0010605	0.429	negative regulation of macromolecule metabolic process
GO:0007154	0.416	cell communication
GO:0010033	0.409	response to organic substance
GO:0071840	0.377	cellular component organization or biogenesis
GO:0051172	0.357	negative regulation of nitrogen compound metabolic process
GO:0016043	0.334	cellular component organization
GO:0051094	0.332	positive regulation of developmental process
GO:0051240	0.326	positive regulation of multicellular organismal process
GO:0023052	0.318	signaling
GO:1902893	0.311	regulation of miRNA transcription
GO:0048583	0.307	regulation of response to stimulus
GO:0007165	0.307	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.988	cytoplasm
GO:0043232	0.429	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]