StarFunc result for job id P11940

User Input

>input (636 residues)
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9C1	0.556	0.556	0.000	636	1.000	1.000	A0A024R9C1.pdb.gz
2	AFDB:H0YAR2	0.600	0.631	0.000	599	0.940	0.998	H0YAR2.pdb.gz	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
3	AFDB:A3KFU5	0.550	0.554	6.666E-100	631	0.770	0.777	A3KFU5.pdb.gz	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
4	AFDB:Q62029	0.378	0.382	7.522E-100	628	0.802	0.812	Q62029.pdb.gz	Q62029_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc2 PE=1 SV=1
5	AFDB:Q98SP8	0.545	0.550	1.010E-98	629	0.720	0.728	Q98SP8.pdb.gz	EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis OX=8355 GN=epabp-a PE=1 SV=2
6	AFDB:Q6PHQ9	0.606	0.584	1.211E-98	660	0.785	0.756	Q6PHQ9.pdb.gz	Q6PHQ9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
7	AFDB:Q6TGY6	0.614	0.630	2.801E-97	620	0.725	0.744	Q6TGY6.pdb.gz
8	AFDB:Q4VXU2	0.610	0.631	4.944E-92	614	0.679	0.704	Q4VXU2.pdb.gz	PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens OX=9606 GN=PABPC1L PE=2 SV=1
9	AFDB:A2A5N3	0.568	0.593	1.031E-84	607	0.607	0.636	A2A5N3.pdb.gz	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
10	AFDB:Q9U302	0.367	0.364	8.818E-80	646	0.550	0.542	Q9U302.pdb.gz	Q9U302_CAEEL Polyadenylate-binding protein OS=Caenorhabditis elegans OX=6239 GN=pab-1 PE=1 SV=1
11	PDB:6r5kH	0.365	0.543	7.000E-39	394	0.354	0.571	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
12	PDB:5vsuA	0.196	0.276	5.877E-23	387	0.112	0.183	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:6y53o	0.142	0.453	1.987E-15	160	0.107	0.425	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:7oqcF	0.120	0.277	1.217E-14	267	0.080	0.191	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:5lsbA	0.124	0.410	3.808E-13	176	0.074	0.267	5lsbA.pdb.gz
16	PDB:7evoD	0.123	0.383	1.063E-12	200	0.074	0.235	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.119	0.399	3.109E-10	178	0.068	0.242	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6ff7X	0.117	0.414	2.424E-9	171	0.053	0.199	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:5yzg1	0.121	0.314	5.279E-8	243	0.080	0.210	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:6gd1A	0.121	0.393	8.559E-8	190	0.050	0.168	6gd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WTT1	1134	588	0.896	0.969	A0A087WTT1_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
2	A2A5N3	741	607	0.618	0.647	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
3	A3KFU5	984	631	0.775	0.781	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
4	A3KFU8	986	644	0.774	0.764	A3KFU8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
5	B1ANR0	987	615	0.781	0.808	B1ANR0_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
6	B2RXY9	742	607	0.618	0.647	B2RXY9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
7	E7EQV3	1226	591	0.929	1.000	E7EQV3_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
8	E7ERJ7	1236	604	0.950	1.000	E7ERJ7_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
9	F1QB54	1151	634	0.885	0.888	PABPA_DANRE Polyadenylate-binding protein 1A OS=Danio rerio OX=7955 GN=pabpc1a PE=1 SV=1
10	H0Y5F5	763	550	0.623	0.720	H0Y5F5_HUMAN Polyadenylate-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
11	H0YAR2	1228	599	0.942	1.000	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
12	P11940	1320	636	1.000	1.000	PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
13	P20965	1204	633	0.942	0.946	PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis OX=8355 GN=pabpc1-a PE=1 SV=3
14	P21187	707	634	0.596	0.598	PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster OX=7227 GN=pAbp PE=1 SV=3
15	P29341	1318	636	0.997	0.997	PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus OX=10090 GN=Pabpc1 PE=1 SV=2
16	P31209	565	653	0.494	0.481	PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
17	P61286	1320	636	1.000	1.000	PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus OX=9913 GN=PABPC1 PE=2 SV=1
18	Q13310	991	644	0.785	0.775	PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
19	Q19579	629	692	0.544	0.500	Q19579_CAEEL Polyadenylate-binding protein OS=Caenorhabditis elegans OX=6239 GN=pab-2 PE=1 SV=1
20	Q3UX16	824	590	0.653	0.703	Q3UX16_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08442 ATP-grasp_2	6.2	17.9	ATP-grasp domain
2	PF03880 DbpA	4.6e+02	12.2	DbpA RNA binding domain
3	PF15023 DUF4523	30	15.8	Protein of unknown function (DUF4523)
4	PF02518 HATPase_c	30	16.5	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
5	PF11608 MARF1_RRM1	0.29	22.7	MARF1, RNA recognition motif 1
6	PF14605 Nup35_RRM_2	0.059	24.7	Nup53/35/40-type RNA recognition motif
7	PF08206 OB_RNB	63	14.7	Ribonuclease B OB domain
8	PF00658 PABP	7.2e-28	107.8	Poly-adenylate binding protein, unique domain
9	PF00076 RRM_1	2.6e-88	301.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
10	PF08777 RRM_3	3.3	19.2	RNA binding motif
11	PF13893 RRM_5	0.00033	31.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
12	PF16367 RRM_7	4.8e-06	37.9	RNA recognition motif
13	PF16842 RRM_occluded	0.22	22.7	Occluded RNA-recognition motif
14	PF11767 SET_assoc	0.0052	27.7	Histone lysine methyltransferase SET associated
15	PF11181 YflT	21	17.1	Heat induced stress protein YflT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008829782.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008831147.1	0.998	Polyadenylate-binding protein-interacting protein 1 isoform X1
2	1026970.XP_008829510.1	0.989	Eukaryotic translation initiation factor 4 gamma 1 isoform X1
3	1026970.XP_008845747.1	0.974	Ataxin-2
4	1026970.XP_008824401.1	0.953	Eukaryotic translation initiation factor 4E
5	1026970.XP_008841052.1	0.951	Y-box binding protein 1
6	1026970.XP_008828136.1	0.948	G1 to S phase transition 1
7	1026970.XP_008836569.1	0.945	Eukaryotic translation initiation factor 4B
8	1026970.XP_008842518.1	0.944	poly(A) binding protein interacting protein 2
9	1026970.XP_008836836.1	0.940	Eukaryotic translation initiation factor 4 gamma 3
10	1026970.XP_008846302.1	0.939	Trinucleotide repeat-containing gene 6C protein isoform X1
11	1026970.XP_008825819.1	0.934	RNA-binding protein 8A isoform X1
12	1026970.XP_008854023.1	0.929	Eukaryotic translation initiation factor 4A1
13	1026970.XP_008823278.1	0.928	PAN3 poly(A) specific ribonuclease subunit
14	1026970.XP_008822751.1	0.923	UPF1, RNA helicase and ATPase
15	1026970.XP_008845828.1	0.920	G1 to S phase transition 2
16	1026970.XP_008847111.1	0.912	Double-stranded RNA-binding protein Staufen homolog 2 isoform X1
17	1026970.XP_008821865.1	0.897	Eukaryotic initiation factor 4A-II isoform X1
18	1026970.XP_008846947.1	0.896	PAN2 poly(A) specific ribonuclease subunit
19	1026970.XP_008824252.1	0.889	Heat shock cognate 71 kDa protein
20	1026970.XP_008846273.1	0.889	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0003729	0.981	mRNA binding
GO:0008143	0.835	poly(A) binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0080090	0.993	regulation of primary metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:0031323	0.993	regulation of cellular metabolic process
GO:0009894	0.988	regulation of catabolic process
GO:0010608	0.988	post-transcriptional regulation of gene expression
GO:0019219	0.981	regulation of nucleobase-containing compound metabolic process
GO:0061013	0.972	regulation of mRNA catabolic process
GO:0009987	0.970	cellular process
GO:2000112	0.970	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.965	regulation of amide metabolic process
GO:0043488	0.952	regulation of mRNA stability
GO:0006417	0.904	regulation of translation
GO:0071704	0.882	organic substance metabolic process
GO:0048518	0.869	positive regulation of biological process
GO:0044238	0.865	primary metabolic process
GO:0006807	0.848	nitrogen compound metabolic process
GO:0044237	0.845	cellular metabolic process
GO:0048519	0.842	negative regulation of biological process
GO:0043170	0.839	macromolecule metabolic process
GO:0009892	0.786	negative regulation of metabolic process
GO:0010605	0.774	negative regulation of macromolecule metabolic process
GO:0009893	0.767	positive regulation of metabolic process
GO:0009895	0.752	negative regulation of catabolic process
GO:0031330	0.736	negative regulation of cellular catabolic process
GO:0048522	0.731	positive regulation of cellular process
GO:0051172	0.717	negative regulation of nitrogen compound metabolic process
GO:1903312	0.706	negative regulation of mRNA metabolic process
GO:0010628	0.700	positive regulation of gene expression
GO:1902369	0.698	negative regulation of RNA catabolic process
GO:1902373	0.692	negative regulation of mRNA catabolic process
GO:0051173	0.682	positive regulation of nitrogen compound metabolic process
GO:0031325	0.680	positive regulation of cellular metabolic process
GO:0045727	0.672	positive regulation of translation
GO:0034641	0.646	cellular nitrogen compound metabolic process
GO:0010467	0.518	gene expression
GO:0006139	0.427	nucleobase-containing compound metabolic process
GO:0090304	0.416	nucleic acid metabolic process
GO:0016070	0.405	RNA metabolic process
GO:0016071	0.335	mRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.937	protein-containing complex
GO:0043227	0.851	membrane-bounded organelle
GO:0043229	0.819	intracellular organelle
GO:0043232	0.804	intracellular non-membrane-bounded organelle
GO:0043231	0.765	intracellular membrane-bounded organelle
GO:0005634	0.700	nucleus
GO:1990904	0.403	ribonucleoprotein complex
GO:0031981	0.367	nuclear lumen
GO:0005654	0.357	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]