StarFunc result for job id P12035

User Input

>input (628 residues)
MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNL
GGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFG
GAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLL
QPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSS
ISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAA
ENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMD
NNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIE
LNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLAR
LLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGG
GYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVS
GGGFSSASNRGGSIKFSQSSQSSQRYSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12035	1.000	1.000	1.674E-75	628	1.000	1.000	P12035.pdb.gz	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
2	AFDB:Q29426	0.260	0.260	5.435E-53	629	0.839	0.838	Q29426.pdb.gz	K2C3_RABIT Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus OX=9986 GN=KRT3 PE=2 SV=1
3	AFDB:Q01546	0.464	0.458	3.281E-52	638	0.772	0.760	Q01546.pdb.gz	K22O_HUMAN Keratin, type II cytoskeletal 2 oral OS=Homo sapiens OX=9606 GN=KRT76 PE=1 SV=2
4	AFDB:Q3UV17	0.503	0.530	2.487E-47	594	0.696	0.736	Q3UV17.pdb.gz	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
5	AFDB:Q922U2	0.276	0.294	3.845E-40	580	0.632	0.684	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
6	AFDB:P13647	0.255	0.270	8.766E-40	590	0.635	0.676	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
7	AFDB:P02538	0.256	0.281	1.038E-38	564	0.621	0.691	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
8	AFDB:Q6PVZ5	0.312	0.325	4.309E-38	599	0.632	0.663	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
9	AFDB:Q8BGZ7	0.277	0.309	9.823E-38	551	0.591	0.673	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
10	AFDB:Q9Z331	0.248	0.275	1.928E-37	562	0.584	0.653	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
11	PDB:5lj5O	0.086	0.160	5.916	283	0.037	0.081	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:7mqaNA	0.053	0.102	7.983	295	0.030	0.064	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7c4jB	0.062	0.096	9.273	395	0.037	0.058	7c4jB.pdb.gz
14	PDB:7mqaSI	0.087	0.070	9.273	803	0.018	0.014	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:8at3A	0.137	0.256	9.273	286	0.061	0.133	8at3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	O95678	587	551	0.514	0.586	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P02538	596	564	0.532	0.592	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
3	P04104	534	637	0.403	0.397	K2C1_MOUSE Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4
4	P04259	603	564	0.561	0.624	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
5	P04264	561	644	0.432	0.421	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
6	P07744	558	525	0.468	0.560	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
7	P12035	1225	628	1.000	1.000	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
8	P13647	591	590	0.527	0.561	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	P19013	588	520	0.495	0.598	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
10	P48668	598	564	0.556	0.619	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
11	P50446	583	553	0.478	0.542	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
12	Q01546	639	638	0.494	0.486	K22O_HUMAN Keratin, type II cytoskeletal 2 oral OS=Homo sapiens OX=9606 GN=KRT76 PE=1 SV=2
13	Q14CN4	535	511	0.459	0.564	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
14	Q29426	670	629	0.506	0.506	K2C3_RABIT Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus OX=9986 GN=KRT3 PE=2 SV=1
15	Q3SY84	561	523	0.508	0.610	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
16	Q5XKE5	587	535	0.490	0.576	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
17	Q7RTS7	531	529	0.470	0.558	K2C74_HUMAN Keratin, type II cytoskeletal 74 OS=Homo sapiens OX=9606 GN=KRT74 PE=1 SV=2
18	Q86Y46	563	540	0.518	0.602	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
19	Q8BGZ7	582	551	0.490	0.559	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
20	Q922U2	585	580	0.444	0.481	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	51	15.4	Afadin- and alpha -actinin-Binding
2	PF08614 ATG16	0.16	23.7	Autophagy protein 16 (ATG16)
3	PF04513 Baculo_PEP_C	4.4e+02	12.3	Baculovirus polyhedron envelope protein, PEP, C terminus
4	PF10473 CENP-F_leu_zip	0.00022	32.7	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF14362 DUF4407	5.8e+02	11.1	Domain of unknown function (DUF4407)
6	PF06103 DUF948	4.2e+02	12.6	Bacterial protein of unknown function (DUF948)
7	PF00038 Filament	2.8e-109	377.1	Intermediate filament protein
8	PF09744 Jnk-SapK_ap_N	6.4e+02	12.1	JNK_SAPK-associated protein-1
9	PF16208 Keratin_2_head	3e-30	116.9	Keratin type II head
10	PF10506 MCC-bdg_PDZ	7.5e+02	11.6	PDZ domain of MCC-2 bdg protein for Usher syndrome
11	PF17078 SHE3	76	14.5	SWI5-dependent HO expression protein 3
12	PF07926 TPR_MLP1_2	0.19	23.2	TPR/MLP1/MLP2-like protein
13	PF06005 ZapB	1.5	20.6	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413479

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000167586	0.886	Keratin, type I cytoskeletal 14
2	9606.ENSP00000252242	0.877	Keratin, type II cytoskeletal 5
3	9606.ENSP00000237612	0.699	ATP-binding cassette sub-family G member 2
4	9606.ENSP00000265371	0.699	Neuropilin-1
5	9606.ENSP00000373487	0.692	Keratin, type I cytoskeletal 18
6	9606.ENSP00000328983	0.600	Carbohydrate sulfotransferase 6
7	9606.ENSP00000266719	0.584	Keratocan
8	9606.ENSP00000252245	0.583	Keratin, type II cytoskeletal 75
9	9606.ENSP00000282561	0.557	Gap junction alpha-1 protein
10	9606.ENSP00000264029	0.547	Trehalase
11	9606.ENSP00000485659	0.536	Mucin-5AC
12	9606.ENSP00000257951	0.532	Keratin, type II cuticular Hb4
13	9606.ENSP00000257974	0.523	Keratin, type II cuticular Hb2
14	9606.ENSP00000267119	0.521	Keratin, type II cytoskeletal 71
15	9606.ENSP00000293745	0.518	Keratin, type II cytoskeletal 72
16	9606.ENSP00000257901	0.511	Keratin, type II cuticular Hb5
17	9606.ENSP00000293670	0.508	Keratin, type II cuticular Hb3
18	9606.ENSP00000369349	0.508	Keratin, type II cuticular Hb1
19	9606.ENSP00000307014	0.507	Keratin, type II cytoskeletal 73
20	9606.ENSP00000307240	0.504	Keratin, type II cytoskeletal 74

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.662	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071840	0.961	cellular component organization or biogenesis
GO:0045103	0.908	intermediate filament-based process
GO:0016043	0.857	cellular component organization
GO:0032502	0.775	developmental process
GO:0048856	0.774	anatomical structure development
GO:0006996	0.484	organelle organization
GO:0009888	0.444	tissue development
GO:0007010	0.430	cytoskeleton organization
GO:0065007	0.421	biological regulation
GO:0032501	0.416	multicellular organismal process
GO:0050789	0.404	regulation of biological process
GO:0050896	0.372	response to stimulus
GO:0050794	0.310	regulation of cellular process
GO:0045104	0.306	intermediate filament cytoskeleton organization
GO:0008544	0.300	epidermis development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0070062	0.999	extracellular exosome
GO:0005882	0.998	intermediate filament
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0045095	0.994	keratin filament
GO:0005634	0.988	nucleus
GO:0016020	0.877	membrane
GO:0071944	0.719	cell periphery
GO:0005886	0.686	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]