StarFunc result for job id P12036

User Input

>input (1026 residues)
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSA
SPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQLQALNDRFAGYIDKVRQLEA
HNRSLEGEAAALRQQQAGRSAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAH
VRQRLDDEARQREEAEAAARALARFAQEAEAARVDLQKKAQALQEECGYLRRHHQEEVGE
LLGQIQGSGAAQAQMQAETRDALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRL
SEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASY
QEAIQQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPIPF
SLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEEEEKEAKE
EEGKEEEGGEEEEAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKS
PAEVKSPEKAKSPAKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKS
PEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEKAKSPEKAKS
PEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSPVKEEAKSPEKAKSPVKE
EAKSPEKAKSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLDVKSPEAKTPAKEEA
RSPADKFPEKAKSPVKEEVKSPEKAKSPLKEDAKAPEKEIPKKEEVKSPVKEEEKPQEVK
VKEPPKKAEEEKAPATPKTEEKKDSKKEEAPKKEAPKPKVEEKKEPAVEKPKESKVEAKK
EEAEDKKKVPTPEKEAPAKVEVKEDAKPKEKTEVAKKEPDDAKAKEPSKPAEKKEAAPEK
KDTKEEKAKKPEEKPKTEAKAKEDDKTLSKEPSKPKAEKAEKSSSTDQKDSKPPEKATED
KAAKGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12036	0.999	0.999	0.000	1026	1.000	1.000	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
2	AFDB:P19246	0.349	0.331	1.080E-83	1090	0.806	0.759	P19246.pdb.gz	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
3	AFDB:P16884	0.196	0.190	2.176E-81	1072	0.816	0.781	P16884.pdb.gz	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
4	AFDB:E7ESP9	0.205	0.231	2.353E-34	877	0.328	0.384	E7ESP9.pdb.gz	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
5	AFDB:P07197	0.240	0.262	2.995E-33	916	0.346	0.388	P07197.pdb.gz	NFM_HUMAN Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3
6	AFDB:P08553	0.264	0.307	3.464E-33	848	0.296	0.358	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
7	AFDB:E7EMV2	0.188	0.266	8.887E-30	698	0.269	0.395	E7EMV2.pdb.gz	E7EMV2_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
8	AFDB:P86839	0.193	0.165	8.321E-11	1265	0.180	0.146	P86839.pdb.gz	NEST_DANRE Nestin OS=Danio rerio OX=7955 GN=nes PE=2 SV=1
9	AFDB:Q4GYI3	0.115	0.127	3.070E-7	912	0.132	0.148	Q4GYI3.pdb.gz	Q4GYI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3940 PE=4 SV=1
10	AFDB:A0A2R8QCI3	0.137	0.074	2.032E-6	2023	0.139	0.071	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
11	PDB:7r5jV0	0.052	0.169	1.055	273	0.039	0.147	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:7yyhK	0.056	0.231	3.629	217	0.019	0.092	7yyhK.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12036	0.0	1935	1026	1.000	1.000	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
2	P16884	0.0	1248	1072	0.809	0.774	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
3	P19246	0.0	1280	1090	0.823	0.774	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
4	P08553	8.80e-121	392	848	0.210	0.254	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
5	E7ESP9	1.68e-120	392	877	0.218	0.255	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
6	P12839	1.42e-119	389	846	0.208	0.252	NFM_RAT Neurofilament medium polypeptide OS=Rattus norvegicus OX=10116 GN=Nefm PE=1 SV=4
7	E7EMV2	2.84e-118	381	698	0.218	0.321	E7EMV2_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
8	Q16352	5.88e-100	325	499	0.205	0.421	AINX_HUMAN Alpha-internexin OS=Homo sapiens OX=9606 GN=INA PE=1 SV=2
9	P46660	9.24e-95	311	501	0.208	0.425	AINX_MOUSE Alpha-internexin OS=Mus musculus OX=10090 GN=Ina PE=1 SV=3
10	P23565	3.14e-90	300	505	0.218	0.444	AINX_RAT Alpha-internexin OS=Rattus norvegicus OX=10116 GN=Ina PE=1 SV=2
11	F1Q8F1	5.56e-88	292	469	0.162	0.354	F1Q8F1_DANRE Internexin neuronal intermediate filament protein, alpha b OS=Danio rerio OX=7955 GN=gefiltin PE=1 SV=1
12	P12037	8.49e-87	277	142	0.134	0.965	NFH_PIG Neurofilament heavy polypeptide (Fragment) OS=Sus scrofa OX=9823 GN=NEFH PE=1 SV=1
13	A2ATX5	4.22e-86	287	474	0.157	0.340	A2ATX5_DANRE Alpha-internexin OS=Danio rerio OX=7955 GN=si:ch211-67n3.6 PE=1 SV=1
14	P08670	2.56e-85	285	466	0.166	0.365	VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4
15	V9HWE1	2.56e-85	285	466	0.166	0.365	V9HWE1_HUMAN Epididymis luminal protein 113 OS=Homo sapiens OX=9606 GN=HEL113 PE=2 SV=1
16	P02543	5.57e-85	284	466	0.180	0.397	VIME_PIG Vimentin OS=Sus scrofa OX=9823 GN=VIM PE=1 SV=2
17	P48616	1.76e-84	283	466	0.166	0.365	VIME_BOVIN Vimentin OS=Bos taurus OX=9913 GN=VIM PE=1 SV=3
18	P20152	2.50e-84	282	466	0.179	0.395	VIME_MOUSE Vimentin OS=Mus musculus OX=10090 GN=Vim PE=1 SV=3
19	P31000	3.57e-84	282	466	0.165	0.363	VIME_RAT Vimentin OS=Rattus norvegicus OX=10116 GN=Vim PE=1 SV=2
20	P48670	4.39e-84	281	448	0.165	0.377	VIME_CRIGR Vimentin (Fragment) OS=Cricetulus griseus OX=10029 GN=VIM PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07142 DUF1388	3.9e-58	204.2	Repeat of unknown function (DUF1388)
2	PF00038 Filament	3.8e-97	337.2	Intermediate filament protein
3	PF03836 RasGAP_C	25	16.4	RasGAP C-terminus
4	PF01166 TSC22	67	15.1	TSC-22/dip/bun family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000408979	0.892	Kinesin heavy chain isoform 5A
2	9606.ENSP00000393379	0.857	Kinesin heavy chain isoform 5C
3	9606.ENSP00000229795	0.846	Mitogen-activated protein kinase 14
4	9606.ENSP00000333685	0.840	Mitogen-activated protein kinase 11
5	9606.ENSP00000414982	0.828	Kinesin light chain 1
6	9606.ENSP00000307078	0.822	Kinesin-1 heavy chain
7	9606.ENSP00000215659	0.818	Mitogen-activated protein kinase 12
8	9606.ENSP00000211287	0.816	Mitogen-activated protein kinase 13
9	9606.ENSP00000399403	0.814	Kinesin light chain 2
10	9606.ENSP00000257860	0.808	Peripherin
11	9606.ENSP00000259708	0.802	Kinesin light chain 4
12	9606.ENSP00000375810	0.802	Kinesin light chain 3
13	9606.ENSP00000419782	0.792	Cyclin-dependent-like kinase 5
14	9606.ENSP00000482169	0.781	Neurofilament light polypeptide
15	9606.ENSP00000221166	0.777	Neurofilament medium polypeptide
16	9606.ENSP00000380958	0.733	Myelin basic protein
17	9606.ENSP00000353508	0.711	Microtubule-associated protein 2
18	9606.ENSP00000270142	0.675	Superoxide dismutase [Cu-Zn]
19	9606.ENSP00000291700	0.668	Protein S100-B
20	9606.ENSP00000463653	0.666	RNA binding protein fox-1 homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005200	1.000	structural constituent of cytoskeleton
GO:0070840	0.995	dynein complex binding
GO:0019900	0.995	kinase binding
GO:0015631	0.995	tubulin binding
GO:0019894	0.994	kinesin binding
GO:0008017	0.993	microtubule binding
GO:0019901	0.990	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0045103	0.965	intermediate filament-based process
GO:0032501	0.961	multicellular organismal process
GO:0006996	0.950	organelle organization
GO:0048856	0.938	anatomical structure development
GO:0045104	0.931	intermediate filament cytoskeleton organization
GO:0007275	0.922	multicellular organism development
GO:0097435	0.921	supramolecular fiber organization
GO:0048731	0.875	system development
GO:0045109	0.875	intermediate filament organization
GO:0048869	0.854	cellular developmental process
GO:0030154	0.844	cell differentiation
GO:0007399	0.837	nervous system development
GO:0061564	0.753	axon development
GO:0044085	0.743	cellular component biogenesis
GO:0009653	0.657	anatomical structure morphogenesis
GO:0022607	0.613	cellular component assembly
GO:0048858	0.545	cell projection morphogenesis
GO:0120039	0.531	plasma membrane bounded cell projection morphogenesis
GO:0050896	0.525	response to stimulus
GO:0048812	0.498	neuron projection morphogenesis
GO:0007409	0.434	axonogenesis
GO:0051716	0.400	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005856	0.999	cytoskeleton
GO:0043005	0.996	neuron projection
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0030424	0.961	axon
GO:0005634	0.945	nucleus
GO:0016234	0.793	inclusion body
GO:0099080	0.616	supramolecular complex
GO:0016020	0.600	membrane
GO:0099513	0.534	polymeric cytoskeletal fiber
GO:0005882	0.512	intermediate filament
GO:0030054	0.422	cell junction
GO:0097418	0.389	neurofibrillary tangle
GO:0005829	0.320	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]