StarFunc result for job id P12074

User Input

>input (109 residues)
MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLK
SHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H6SG15	0.767	0.767	7.655E-19	109	1.000	1.000	H6SG15.pdb.gz	H6SG15_HUMAN Cytochrome c oxidase subunit OS=Homo sapiens OX=9606 GN=COX6A1 PE=2 SV=1
2	AFDB:P43024	0.728	0.717	9.375E-17	111	0.835	0.820	P43024.pdb.gz	CX6A1_MOUSE Cytochrome c oxidase subunit 6A1, mitochondrial OS=Mus musculus OX=10090 GN=Cox6a1 PE=1 SV=2
3	AFDB:P43023	0.656	0.735	6.401E-11	97	0.541	0.608	P43023.pdb.gz	CX6A2_MOUSE Cytochrome c oxidase subunit 6A2, mitochondrial OS=Mus musculus OX=10090 GN=Cox6a2 PE=1 SV=2
4	AFDB:Q02221	0.657	0.736	1.984E-10	97	0.514	0.577	Q02221.pdb.gz	CX6A2_HUMAN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX6A2 PE=1 SV=2
5	AFDB:P07471	0.620	0.695	1.009E-9	97	0.495	0.557	P07471.pdb.gz	CX6A2_BOVIN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Bos taurus OX=9913 GN=COX6A2 PE=1 SV=2
6	PDB:2y69G	0.613	0.789	1.024E-8	84	0.459	0.595	2y69G.pdb.gz	A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
7	AFDB:Q9W1N3	0.604	0.604	2.109E-8	109	0.413	0.413	Q9W1N3.pdb.gz	Q9W1N3_DROME Levy, isoform A OS=Drosophila melanogaster OX=7227 GN=levy PE=1 SV=1
8	AFDB:Q20779	0.533	0.465	2.664E-5	128	0.312	0.266	Q20779.pdb.gz	COX6A_CAEEL Cytochrome c oxidase subunit 6A, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cox-6A PE=3 SV=1
9	AFDB:O74471	0.455	0.394	5.191E-4	130	0.321	0.269	O74471.pdb.gz	COX13_SCHPO Cytochrome c oxidase subunit 13, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox13 PE=1 SV=1
10	AFDB:P32799	0.485	0.414	2.291E-3	129	0.339	0.287	P32799.pdb.gz	COX13_YEAST Cytochrome c oxidase subunit 13, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX13 PE=1 SV=1
11	AFDB:Q5ALV9	0.464	0.388	3.758E-3	134	0.275	0.224	Q5ALV9.pdb.gz	Q5ALV9_CANAL Cytochrome c oxidase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX13 PE=3 SV=1
12	PDB:6zdbA	0.236	0.209	1.058	129	0.156	0.132	6zdbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H6SG15	3.05e-77	224	109	1.000	1.000	H6SG15_HUMAN Cytochrome c oxidase subunit OS=Homo sapiens OX=9606 GN=COX6A1 PE=2 SV=1
2	P12074	3.05e-77	224	109	1.000	1.000	CX6A1_HUMAN Cytochrome c oxidase subunit 6A1, mitochondrial OS=Homo sapiens OX=9606 GN=COX6A1 PE=1 SV=4
3	P43024	4.74e-63	189	111	0.835	0.820	CX6A1_MOUSE Cytochrome c oxidase subunit 6A1, mitochondrial OS=Mus musculus OX=10090 GN=Cox6a1 PE=1 SV=2
4	P43023	7.29e-37	122	97	0.560	0.629	CX6A2_MOUSE Cytochrome c oxidase subunit 6A2, mitochondrial OS=Mus musculus OX=10090 GN=Cox6a2 PE=1 SV=2
5	H0YIV9	2.63e-36	123	168	0.532	0.345	H0YIV9_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
6	P10817	9.35e-36	119	94	0.541	0.628	CX6A2_RAT Cytochrome c oxidase subunit 6A2, mitochondrial (Fragment) OS=Rattus norvegicus OX=10116 GN=Cox6a2 PE=1 SV=3
7	P07471	1.67e-32	111	97	0.523	0.588	CX6A2_BOVIN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Bos taurus OX=9913 GN=COX6A2 PE=1 SV=2
8	Q02221	1.76e-29	103	97	0.459	0.515	CX6A2_HUMAN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX6A2 PE=1 SV=2
9	Q9W1N3	1.94e-28	101	109	0.486	0.486	Q9W1N3_DROME Levy, isoform A OS=Drosophila melanogaster OX=7227 GN=levy PE=1 SV=1
10	Q20779	5.56e-16	70.1	128	0.303	0.258	COX6A_CAEEL Cytochrome c oxidase subunit 6A, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cox-6A PE=3 SV=1
11	P32799	4.42e-12	60.1	129	0.312	0.264	COX13_YEAST Cytochrome c oxidase subunit 13, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX13 PE=1 SV=1
12	Q5ALV9	6.38e-10	54.7	134	0.275	0.224	Q5ALV9_CANAL Cytochrome c oxidase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX13 PE=3 SV=1
13	O74471	3.50e-08	50.1	130	0.239	0.200	COX13_SCHPO Cytochrome c oxidase subunit 13, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox13 PE=1 SV=1
14	Q9T070	1.93e-07	47.4	102	0.349	0.373	COX6A_ARATH Cytochrome c oxidase subunit 6a, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX6A PE=3 SV=1
15	O88177	0.19	32.7	359	0.156	0.047	PEX12_RAT Peroxisome assembly protein 12 OS=Rattus norvegicus OX=10116 GN=Pex12 PE=2 SV=1
16	P35084	0.27	32.3	1727	0.174	0.011	RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum OX=44689 GN=polr2a PE=2 SV=2
17	Q9XZ06	0.51	31.6	823	0.183	0.024	NU931_DROME Nuclear pore complex protein Nup93-1 OS=Drosophila melanogaster OX=7227 GN=Nup93-1 PE=1 SV=1
18	P15151	0.95	30.4	417	0.183	0.048	PVR_HUMAN Poliovirus receptor OS=Homo sapiens OX=9606 GN=PVR PE=1 SV=2
19	P52948	2.8	29.3	1817	0.220	0.013	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4
20	Q60673	3.6	28.9	979	0.119	0.013	PTPRN_MOUSE Receptor-type tyrosine-protein phosphatase-like N OS=Mus musculus OX=10090 GN=Ptprn PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02046 COX6A	1.5e-14	65.8	Cytochrome c oxidase subunit VIa

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246554	0.999	Cytochrome c oxidase subunit 6B1
2	9606.ENSP00000258424	0.999	Cytochrome c oxidase subunit 5B, mitochondrial
3	9606.ENSP00000317780	0.999	Cytochrome c oxidase subunit 5A, mitochondrial
4	9606.ENSP00000425759	0.998	Cytochrome c oxidase subunit 7C, mitochondrial
5	9606.ENSP00000428895	0.998	Cytochrome c oxidase subunit 6C
6	9606.ENSP00000354982	0.997	Cytochrome c oxidase subunit 3
7	9606.ENSP00000354876	0.993	Cytochrome c oxidase subunit 2
8	9606.ENSP00000457513	0.993	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
9	9606.ENSP00000321260	0.991	Cytochrome c oxidase subunit 8A, mitochondrial
10	9606.ENSP00000367939	0.991	Cytochrome b-c1 complex subunit 8
11	9606.ENSP00000339720	0.989	Cytochrome c oxidase subunit NDUFA4
12	9606.ENSP00000354499	0.989	Cytochrome c oxidase subunit 1
13	9606.ENSP00000430494	0.989	Cytochrome b-c1 complex subunit 7
14	9606.ENSP00000359098	0.986	Cytochrome c oxidase subunit 7A2, mitochondrial
15	9606.ENSP00000417656	0.985	Cytochrome c oxidase subunit 7B, mitochondrial
16	9606.ENSP00000332887	0.984	Cytochrome b-c1 complex subunit 9
17	9606.ENSP00000467266	0.978	Cytochrome c oxidase subunit 6B2
18	9606.ENSP00000307786	0.977	Cytochrome c
19	9606.ENSP00000306397	0.975	Cytochrome b-c1 complex subunit Rieske, mitochondrial
20	9606.ENSP00000317159	0.971	Cytochrome c1, heme protein, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.680	catalytic activity
GO:0022857	0.583	transmembrane transporter activity
GO:0030234	0.539	enzyme regulator activity
GO:0016491	0.350	oxidoreductase activity
GO:0022804	0.333	active transmembrane transporter activity
GO:0009055	0.332	electron transfer activity
GO:0015399	0.313	primary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0006091	0.969	generation of precursor metabolites and energy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0098796	0.998	membrane protein complex
GO:0031090	0.987	organelle membrane
GO:0005740	0.978	mitochondrial envelope
GO:0005743	0.968	mitochondrial inner membrane
GO:0098800	0.963	inner mitochondrial membrane protein complex
GO:0005746	0.961	mitochondrial respirasome
GO:1902494	0.952	catalytic complex
GO:0098803	0.942	respiratory chain complex
GO:0070069	0.835	cytochrome complex
GO:0045277	0.639	respiratory chain complex IV
GO:0005751	0.545	mitochondrial respiratory chain complex IV

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.350	Oxidoreductases.
EC:7.-.-.-	0.313	Translocases.

[back to server]