StarFunc result for job id P12081

User Input

>input (509 residues)
MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPK
GTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
NFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDK
LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLG
DLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAG
GRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKL
LEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRS
VTSREEVDVRREDLVEEIKRRTGQPLCIC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7ETE2	0.908	0.902	9.224E-86	512	1.000	0.994	E7ETE2.pdb.gz	E7ETE2_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2
2	AFDB:E9QI36	0.885	0.879	1.191E-73	513	0.770	0.764	E9QI36.pdb.gz	HARS1_DANRE Histidine--tRNA ligase OS=Danio rerio OX=7955 GN=hars PE=3 SV=2
3	PDB:4phcA	0.844	0.964	6.841E-72	444	0.872	1.000	4phcA.pdb.gz	Comparison of histidine recognition in human and trypanosomatid histidyl-tRNA synthetases.
4	AFDB:A0A2R8Y5P7	0.873	0.868	2.848E-71	512	0.711	0.707	A0A2R8Y5P7.pdb.gz	A0A2R8Y5P7_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
5	AFDB:B4DDD8	0.768	0.895	1.173E-69	435	0.855	1.000	B4DDD8.pdb.gz	B4DDD8_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
6	PDB:6o76B	0.789	0.890	4.508E-68	451	0.882	0.996	6o76B.pdb.gz
7	AFDB:Q99KK9	0.856	0.863	3.607E-67	505	0.660	0.665	Q99KK9.pdb.gz	SYHM_MOUSE Histidine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Hars2 PE=1 SV=1
8	PDB:4g85A	0.828	0.986	1.611E-65	427	0.837	0.998	4g85A.pdb.gz
9	AFDB:Q8IQX8	0.873	0.791	7.799E-65	564	0.637	0.574	Q8IQX8.pdb.gz	Q8IQX8_DROME histidine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=HisRS PE=1 SV=2
10	AFDB:B4E1C5	0.657	0.847	6.549E-62	395	0.776	1.000	B4E1C5.pdb.gz	B4E1C5_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
11	AFDB:A0A2R8Y3N3	0.785	0.843	1.392E-61	473	0.656	0.706	A0A2R8Y3N3.pdb.gz	A0A2R8Y3N3_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
12	AFDB:O43011	0.843	0.765	7.132E-58	563	0.542	0.490	O43011.pdb.gz	SYH_SCHPO Histidine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hts1 PE=1 SV=2
13	AFDB:P34183	0.839	0.821	1.793E-55	521	0.546	0.534	P34183.pdb.gz	SYH_CAEEL Histidine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=hars-1 PE=2 SV=3
14	PDB:4x5oB	0.680	0.987	2.838E-52	350	0.684	0.994	4x5oB.pdb.gz
15	PDB:3hriA	0.665	0.829	1.024E-25	401	0.208	0.264	3hriA.pdb.gz
16	PDB:1kmmC	0.618	0.795	9.906E-24	387	0.177	0.233	1kmmC.pdb.gz	The first step of aminoacylation at the atomic level in histidyl-tRNA synthetase.
17	PDB:1httA	0.613	0.836	6.686E-23	366	0.165	0.230	1httA.pdb.gz	Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate.
18	PDB:3hriF	0.627	0.847	8.595E-23	370	0.202	0.278	3hriF.pdb.gz
19	PDB:1qf6A	0.516	0.423	1.235E-15	641	0.112	0.089	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
20	PDB:5e6mA	0.431	0.424	1.524E-14	519	0.147	0.145	5e6mA.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y3N3	0.0	687	473	0.652	0.702	A0A2R8Y3N3_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
2	A0A2R8Y5P7	0.0	764	512	0.705	0.701	A0A2R8Y5P7_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
3	A0A2R8Y6I1	0.0	730	436	0.676	0.789	A0A2R8Y6I1_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
4	B4DDD8	0.0	675	435	0.658	0.770	B4DDD8_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
5	B4E1C5	0.0	676	395	0.658	0.848	B4E1C5_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
6	D6RJE6	0.0	512	293	0.472	0.819	D6RJE6_HUMAN Histidyl-tRNA synthetase 2, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=2
7	E7ETE2	0.0	1020	512	1.000	0.994	E7ETE2_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2
8	E9QI36	0.0	802	513	0.776	0.770	HARS1_DANRE Histidine--tRNA ligase OS=Danio rerio OX=7955 GN=hars PE=3 SV=2
9	M9PHI2	0.0	645	554	0.621	0.570	M9PHI2_DROME histidine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=HisRS PE=1 SV=1
10	P12081	0.0	1025	509	1.000	1.000	HARS1_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2
11	P34183	0.0	521	521	0.530	0.518	SYH_CAEEL Histidine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=hars-1 PE=2 SV=3
12	P49590	0.0	764	506	0.705	0.709	SYHM_HUMAN Histidine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
13	Q8IQX8	0.0	646	564	0.621	0.560	Q8IQX8_DROME histidine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=HisRS PE=1 SV=2
14	Q99KK9	0.0	711	505	0.666	0.671	SYHM_MOUSE Histidine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Hars2 PE=1 SV=1
15	Q9VWT1	0.0	662	522	0.644	0.628	Q9VWT1_DROME histidine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=HisRS PE=1 SV=1
16	O43011	3.23e-180	519	563	0.530	0.480	SYH_SCHPO Histidine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hts1 PE=1 SV=2
17	P07263	7.77e-165	479	546	0.475	0.443	SYH_YEAST Histidine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HTS1 PE=1 SV=2
18	Q550L8	2.73e-53	196	1358	0.279	0.105	IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum OX=44689 GN=ifkB PE=2 SV=1
19	Q558U1	6.99e-52	192	2258	0.277	0.062	IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum OX=44689 GN=ifkA PE=2 SV=1
20	Q584V0	1.13e-39	152	477	0.246	0.262	Q584V0_TRYB2 histidine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.280 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03129 HGTP_anticodon	1.5e-14	65.2	Anticodon binding domain
2	PF12745 HGTP_anticodon2	1.8e-08	45.8	Anticodon binding domain of tRNAs
3	PF12836 HHH_3	37	15.9	Helix-hairpin-helix motif
4	PF15595 Imm51	5.1e+02	11.9	Immunity protein 51
5	PF00152 tRNA-synt_2	82	13.7	tRNA synthetases class II (D, K and N)
6	PF01409 tRNA-synt_2d	1.9e+02	12.9	tRNA synthetases class II core domain (F)
7	PF13393 tRNA-synt_His	6.2e-38	142.4	Histidyl-tRNA synthetase
8	PF10139 Virul_Fac	4.3e+02	10.5	Putative bacterial virulence factor
9	PF00458 WHEP-TRS	1.4e-06	39.6	WHEP-TRS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000425634

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325448	0.980	Lysine--tRNA ligase
2	9606.ENSP00000261772	0.974	Alanine--tRNA ligase, cytoplasmic
3	9606.ENSP00000362576	0.972	Tyrosine--tRNA ligase, cytoplasmic
4	9606.ENSP00000355890	0.955	Bifunctional glutamate/proline--tRNA ligase
5	9606.ENSP00000373918	0.945	Glycine--tRNA ligase
6	9606.ENSP00000387710	0.942	Threonine--tRNA ligase, cytoplasmic
7	9606.ENSP00000338093	0.929	Probable threonine--tRNA ligase 2, cytoplasmic
8	9606.ENSP00000300648	0.927	eIF-2-alpha kinase activator GCN1
9	9606.ENSP00000262027	0.924	Methionine--tRNA ligase, cytoplasmic
10	9606.ENSP00000256854	0.890	Asparagine--tRNA ligase, cytoplasmic
11	9606.ENSP00000377954	0.888	Leucine--tRNA ligase, cytoplasmic
12	9606.ENSP00000364794	0.878	Isoleucine--tRNA ligase, cytoplasmic
13	9606.ENSP00000244571	0.877	Alanine--tRNA ligase, mitochondrial
14	9606.ENSP00000231198	0.876	Probable tRNA(His) guanylyltransferase
15	9606.ENSP00000347495	0.863	Tryptophan--tRNA ligase, cytoplasmic
16	9606.ENSP00000234677	0.861	Serine--tRNA ligase, cytoplasmic
17	9606.ENSP00000280326	0.850	T-complex protein 1 subunit epsilon
18	9606.ENSP00000281038	0.849	Probable asparagine--tRNA ligase, mitochondrial
19	9606.ENSP00000230771	0.836	Probable histidine--tRNA ligase, mitochondrial
20	9606.ENSP00000256383	0.830	Eukaryotic translation initiation factor 2 subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004821	1.000	histidine-tRNA ligase activity
GO:0005524	1.000	ATP binding
GO:0042803	0.997	protein homodimerization activity
GO:0003676	0.888	nucleic acid binding
GO:0003723	0.866	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0016070	0.995	RNA metabolic process
GO:0006399	0.991	tRNA metabolic process
GO:0043038	0.988	amino acid activation
GO:0006412	0.988	translation
GO:0006418	0.970	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005634	0.484	nucleus
GO:0043233	0.417	organelle lumen
GO:0070013	0.399	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17313	1.000	ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His)
EC:6.1.1.21	1.000	histidine--tRNA ligase.

[back to server]