StarFunc result for job id P12104

User Input

>input (132 residues)
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12104	1.000	1.000	5.983E-23	132	1.000	1.000	P12104.pdb.gz	FABPI_HUMAN Fatty acid-binding protein, intestinal OS=Homo sapiens OX=9606 GN=FABP2 PE=1 SV=2
2	AFDB:P02693	0.993	0.993	1.256E-19	132	0.818	0.818	P02693.pdb.gz	FABPI_RAT Fatty acid-binding protein, intestinal OS=Rattus norvegicus OX=10116 GN=Fabp2 PE=1 SV=4
3	PDB:2mo5A	0.915	0.855	1.060E-18	142	0.992	0.923	2mo5A.pdb.gz
4	AFDB:B5X5J4	0.981	0.981	3.638E-18	132	0.644	0.644	B5X5J4.pdb.gz	B5X5J4_SALSA Fatty acid-binding protein, intestinal OS=Salmo salar OX=8030 GN=FABPI PE=2 SV=1
5	AFDB:Q8AX65	0.987	0.987	1.442E-17	132	0.659	0.659	Q8AX65.pdb.gz	Q8AX65_DANRE Fatty acid-binding protein, intestinal OS=Danio rerio OX=7955 GN=ifabp PE=1 SV=1
6	AFDB:B5XC78	0.993	0.993	4.902E-17	132	0.621	0.621	B5XC78.pdb.gz	B5XC78_SALSA Fatty acid-binding protein, intestinal OS=Salmo salar OX=8030 GN=FABPI PE=2 SV=1
7	PDB:7yf1A	0.913	0.907	7.030E-12	133	0.318	0.316	7yf1A.pdb.gz
8	AFDB:O97788	0.910	0.910	7.855E-12	132	0.341	0.341	O97788.pdb.gz	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
9	PDB:5hz9A	0.913	0.894	8.192E-12	135	0.318	0.311	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
10	AFDB:P05413	0.912	0.905	9.153E-12	133	0.318	0.316	P05413.pdb.gz	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
11	PDB:5ggeA	0.883	0.902	9.546E-12	129	0.303	0.310	5ggeA.pdb.gz
12	AFDB:O15540	0.913	0.913	9.632E-12	132	0.341	0.341	O15540.pdb.gz	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
13	PDB:2qm9A	0.901	0.858	1.057E-11	139	0.311	0.295	2qm9A.pdb.gz	Structural Basis for Activation of Fatty Acid-binding Protein 4
14	AFDB:P04117	0.909	0.909	1.067E-11	132	0.318	0.318	P04117.pdb.gz	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
15	AFDB:A0A0K0MJN3	0.911	0.911	1.376E-11	132	0.295	0.295	A0A0K0MJN3.pdb.gz	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
16	PDB:3p6dA	0.914	0.870	1.949E-11	139	0.318	0.302	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
17	PDB:5ur9F	0.889	0.853	2.159E-11	138	0.250	0.239	5ur9F.pdb.gz	The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.
18	PDB:7e25A	0.906	0.863	3.246E-11	139	0.341	0.324	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.
19	PDB:5bvsA	0.919	0.919	3.981E-11	132	0.303	0.303	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
20	PDB:4a60A	0.902	0.848	4.189E-11	141	0.280	0.262	4a60A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12104	4.89e-93	266	132	1.000	1.000	FABPI_HUMAN Fatty acid-binding protein, intestinal OS=Homo sapiens OX=9606 GN=FABP2 PE=1 SV=2
2	P02693	1.88e-76	224	132	0.818	0.818	FABPI_RAT Fatty acid-binding protein, intestinal OS=Rattus norvegicus OX=10116 GN=Fabp2 PE=1 SV=4
3	B5XAH0	8.57e-61	184	132	0.644	0.644	B5XAH0_SALSA Fatty acid-binding protein, intestinal OS=Salmo salar OX=8030 GN=FABPI PE=2 SV=1
4	B5X5J4	9.45e-61	184	132	0.644	0.644	B5X5J4_SALSA Fatty acid-binding protein, intestinal OS=Salmo salar OX=8030 GN=FABPI PE=2 SV=1
5	B5X708	2.53e-60	183	132	0.644	0.644	B5X708_SALSA Fatty acid-binding protein, intestinal OS=Salmo salar OX=8030 GN=FABPI PE=2 SV=1
6	B5X744	7.75e-60	182	132	0.636	0.636	B5X744_SALSA Fatty acid-binding protein, intestinal OS=Salmo salar OX=8030 GN=FABPI PE=2 SV=1
7	Q8AX65	9.34e-60	182	132	0.659	0.659	Q8AX65_DANRE Fatty acid-binding protein, intestinal OS=Danio rerio OX=7955 GN=ifabp PE=1 SV=1
8	B5XC78	3.58e-57	175	132	0.621	0.621	B5XC78_SALSA Fatty acid-binding protein, intestinal OS=Salmo salar OX=8030 GN=FABPI PE=2 SV=1
9	O97788	6.58e-21	83.6	132	0.348	0.348	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
10	O15540	3.56e-20	82.0	132	0.348	0.348	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
11	P11404	7.43e-19	78.6	133	0.326	0.323	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
12	P55051	9.49e-19	78.2	132	0.333	0.333	FABP7_RAT Fatty acid-binding protein, brain OS=Rattus norvegicus OX=10116 GN=Fabp7 PE=1 SV=2
13	P05413	2.54e-18	77.0	133	0.326	0.323	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
14	P04117	3.70e-18	76.6	132	0.326	0.326	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
15	Q05423	6.55e-18	75.9	132	0.326	0.326	FABP7_CHICK Fatty acid-binding protein, brain OS=Gallus gallus OX=9031 GN=FABP7 PE=2 SV=2
16	P07483	1.05e-17	75.5	133	0.318	0.316	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
17	P70623	1.44e-17	75.1	132	0.318	0.318	FABP4_RAT Fatty acid-binding protein, adipocyte OS=Rattus norvegicus OX=10116 GN=Fabp4 PE=1 SV=3
18	P51880	1.78e-17	75.1	132	0.318	0.318	FABP7_MOUSE Fatty acid-binding protein, brain OS=Mus musculus OX=10090 GN=Fabp7 PE=1 SV=2
19	P15090	1.05e-16	72.8	132	0.326	0.326	FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens OX=9606 GN=FABP4 PE=1 SV=3
20	B0FLN8	7.78e-16	70.9	137	0.341	0.328	B0FLN8_CHICK Cellular retinoic acid binding protein I OS=Gallus gallus OX=9031 GN=CRABP-I PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	1.5e-13	62.7	Lipocalin / cytosolic fatty-acid binding protein family
2	PF13648 Lipocalin_4	5.2	19.4	Lipocalin-like domain
3	PF14651 Lipocalin_7	3.8e-05	35.1	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274024

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245206	0.927	Aspartate aminotransferase, mitochondrial
2	9606.ENSP00000295834	0.926	Fatty acid-binding protein, liver
3	9606.ENSP00000377549	0.876	Gastrotropin
4	9606.ENSP00000244289	0.748	Hormone-sensitive lipase
5	9606.ENSP00000226578	0.739	Beta-mannosidase
6	9606.ENSP00000256104	0.695	Fatty acid-binding protein, adipocyte
7	9606.ENSP00000245787	0.674	Insulin-induced gene 2 protein
8	9606.ENSP00000252997	0.648	Transcription factor GATA-5
9	9606.ENSP00000252595	0.634	Long-chain fatty acid transport protein 1
10	9606.ENSP00000234396	0.620	V-type proton ATPase subunit B, kidney isoform
11	9606.ENSP00000320886	0.616	Carbohydrate-responsive element-binding protein
12	9606.ENSP00000350425	0.614	Apolipoprotein A-IV
13	9606.ENSP00000341550	0.608	Sodium/potassium/calcium exchanger 5
14	9606.ENSP00000344741	0.605	Insulin-induced gene 1 protein
15	9606.ENSP00000290649	0.604	E3 ubiquitin-protein ligase AMFR
16	9606.ENSP00000269216	0.586	Transcription factor GATA-6
17	9606.ENSP00000385523	0.583	Peroxisome proliferator-activated receptor alpha
18	9606.ENSP00000411613	0.572	Amiloride-sensitive amine oxidase [copper-containing]
19	9606.ENSP00000217407	0.571	Lipopolysaccharide-binding protein
20	9606.ENSP00000300456	0.556	Long-chain fatty acid transport protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036041	0.999	long-chain fatty acid binding
GO:0005515	0.995	protein binding
GO:0005501	0.341	retinoid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.975	multicellular organismal process
GO:0010876	0.862	lipid localization
GO:0006810	0.776	transport
GO:0071702	0.745	organic substance transport
GO:0007586	0.718	digestion
GO:0009987	0.672	cellular process
GO:0003008	0.648	system process
GO:0008152	0.624	metabolic process
GO:0006869	0.601	lipid transport
GO:0071704	0.575	organic substance metabolic process
GO:0022600	0.556	digestive system process
GO:0044238	0.483	primary metabolic process
GO:0050896	0.422	response to stimulus
GO:0044237	0.403	cellular metabolic process
GO:0050892	0.347	intestinal absorption

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.947	cytosol
GO:0043227	0.922	membrane-bounded organelle
GO:0043229	0.919	intracellular organelle
GO:0071944	0.915	cell periphery
GO:0043231	0.914	intracellular membrane-bounded organelle
GO:0016020	0.894	membrane
GO:0005886	0.781	plasma membrane
GO:0005634	0.423	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]