StarFunc result for job id P12109

User Input

>input (1028 residues)
MRAARALLPLLLQACWTAAQDEPETPRAVAFQDCPVDLFFVLDTSESVALRLKPYGALVD
KVKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIQGLTRMPGGRDALKSSVDAV
KYFGKGTYTDCAIKKGLEQLLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAK
HLGVKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEAISQTIDTIVDMIK
NNVEQVCCSFECQPARGPPGLRGDPGFEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGM
KGEKGSRGEKGSRGPKGYKGEKGKRGIDGVDGVKGEMGYPGLPGCKGSPGFDGIQGPPGP
KGDPGAFGLKGEKGEPGADGEAGRPGSSGPSGDEGQPGEPGPPGEKGEAGDEGNPGPDGA
PGERGGPGERGPRGTPGTRGPRGDPGEAGPQGDQGREGPVGVPGDPGEAGPIGPKGYRGD
EGPPGSEGARGAPGPAGPPGDPGLMGERGEDGPAGNGTEGFPGFPGYPGNRGAPGINGTK
GYPGLKGDEGEAGDPGDDNNDIAPRGVKGAKGYRGPEGPQGPPGHQGPPGPDECEILDII
MKMCSCCECKCGPIDLLFVLDSSESIGLQNFEIAKDFVVKVIDRLSRDELVKFEPGQSYA
GVVQYSHSQMQEHVSLRSPSIRNVQELKEAIKSLQWMAGGTFTGEALQYTRDQLLPPSPN
NRIALVITDGRSDTQRDTTPLNVLCSPGIQVVSVGIKDVFDFIPGSDQLNVISCQGLAPS
QGRPGLSLVKENYAELLEDAFLKNVTAQICIDKKCPDYTCPITFSSPADITILLDGSASV
GSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQYSGTGQQRPERASLQFLQNYTAL
ASAVDAMDFINDATDVNDALGYVTRFYREASSGAAKKRLLLFSDGNSQGATPAAIEKAVQ
EAQRAGIEIFVVVVGRQVNEPHIRVLVTGKTAEYDVAYGESHLFRVPSYQALLRGVFHQT
VSRKVALG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZUL3	0.458	0.460	0.000	1025	0.893	0.896	D3ZUL3.pdb.gz	D3ZUL3_RAT Collagen type VI alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col6a1 PE=1 SV=2
2	AFDB:P12109	1.000	1.000	0.000	1028	1.000	1.000	P12109.pdb.gz	CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens OX=9606 GN=COL6A1 PE=1 SV=3
3	AFDB:F1Q6P3	0.414	0.422	3.541E-101	1007	0.543	0.554	F1Q6P3.pdb.gz	F1Q6P3_DANRE Collagen alpha-1(VI) chain OS=Danio rerio OX=7955 GN=col6a1 PE=1 SV=2
4	AFDB:E7FCV8	0.325	0.329	1.376E-57	1015	0.351	0.356	E7FCV8.pdb.gz	E7FCV8_DANRE Collagen alpha-2(VI) chain isoform X4 OS=Danio rerio OX=7955 GN=col6a2 PE=1 SV=3
5	AFDB:A6NMZ7	0.179	0.095	2.009E-27	2263	0.239	0.109	A6NMZ7.pdb.gz	CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2
6	AFDB:Q2UY11	0.175	0.159	1.290E-23	1141	0.286	0.258	Q2UY11.pdb.gz	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
7	AFDB:Q2UY09	0.218	0.202	4.777E-23	1125	0.288	0.263	Q2UY09.pdb.gz	COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens OX=9606 GN=COL28A1 PE=2 SV=2
8	PDB:4nehA	0.141	0.134	2.873E-9	1084	0.039	0.037	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
9	PDB:4nenA	0.140	0.136	1.192E-8	1063	0.043	0.041	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
10	AFDB:Q9TXR6	0.152	0.143	4.101E-8	1094	0.078	0.073	Q9TXR6.pdb.gz	Q9TXR6_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=2
11	PDB:2xwbF	0.149	0.208	8.055E-7	714	0.040	0.057	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
12	PDB:6jp8F	0.156	0.165	1.270E-6	973	0.037	0.039	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
13	PDB:6gym6	0.152	0.421	1.345E-6	335	0.024	0.075	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
14	PDB:7zs96	0.150	0.368	2.244E-6	383	0.031	0.084	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
15	PDB:7ad8D	0.131	0.394	2.662E-6	280	0.031	0.114	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
16	PDB:3jcoW	0.161	0.734	3.653E-5	197	0.025	0.132	3jcoW.pdb.gz
17	PDB:6gvwD	0.145	0.520	4.093E-5	239	0.031	0.134	6gvwD.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
18	PDB:7ena2	0.157	0.379	6.832E-5	385	0.021	0.057	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	AFDB:Q54LJ4	0.142	0.061	3.413E-3	2563	0.032	0.013	Q54LJ4.pdb.gz	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
20	AFDB:D3ZW15	0.135	0.113	4.286E-3	1242	0.107	0.089	D3ZW15.pdb.gz	D3ZW15_RAT SEC24 homolog B, COPII coat complex component OS=Rattus norvegicus OX=10116 GN=Sec24b PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZUL3	0.0	1664	1034	0.894	0.889	D3ZUL3_RAT Collagen type VI alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col6a1 PE=1 SV=2
2	F1Q6P3	0.0	977	1007	0.547	0.558	F1Q6P3_DANRE Collagen alpha-1(VI) chain OS=Danio rerio OX=7955 GN=col6a1 PE=1 SV=2
3	P12109	0.0	2067	1028	1.000	1.000	CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens OX=9606 GN=COL6A1 PE=1 SV=3
4	Q04857	0.0	1701	1025	0.900	0.902	CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus OX=10090 GN=Col6a1 PE=1 SV=1
5	Q8TBN2	0.0	856	439	0.409	0.957	Q8TBN2_HUMAN VWFA domain-containing protein (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
6	P12110	3.67e-144	459	1019	0.345	0.348	CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens OX=9606 GN=COL6A2 PE=1 SV=4
7	Q02788	6.93e-140	448	1034	0.346	0.344	CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus OX=10090 GN=Col6a2 PE=1 SV=3
8	F1LNH3	3.96e-139	446	1038	0.347	0.344	F1LNH3_RAT Collagen type VI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col6a2 PE=4 SV=3
9	A0A8I5ZTZ9	1.93e-137	440	973	0.334	0.353	A0A8I5ZTZ9_RAT Collagen type VI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col6a2 PE=1 SV=1
10	E7FCV8	1.94e-130	422	1015	0.327	0.331	E7FCV8_DANRE Collagen alpha-2(VI) chain isoform X4 OS=Danio rerio OX=7955 GN=col6a2 PE=1 SV=3
11	A0A8I5Y5R7	1.50e-117	385	926	0.300	0.333	A0A8I5Y5R7_RAT Collagen type VI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col6a2 PE=1 SV=1
12	A0A8I6ALT7	5.08e-88	306	991	0.250	0.259	A0A8I6ALT7_RAT Collagen type VI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col6a2 PE=1 SV=1
13	Q1T7A8	2.73e-67	223	117	0.105	0.923	Q1T7A8_PIG Type VI collagen alpha-1 chain (Fragment) OS=Sus scrofa OX=9823 GN=COL6A1 PE=2 SV=1
14	O88493	9.85e-65	242	2657	0.240	0.093	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
15	A2AX52	1.09e-64	242	2309	0.237	0.106	CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2
16	J3QQ16	1.57e-59	226	2677	0.239	0.092	J3QQ16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
17	A0A087WS16	1.73e-59	226	2677	0.239	0.092	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
18	Q05504	2.07e-59	223	959	0.211	0.226	Q05504_MOUSE Collagen alpha 3 chain type VI (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
19	P12111	2.06e-55	213	3177	0.250	0.081	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
20	A0A8I6ADR1	1.85e-52	204	2708	0.224	0.085	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18652 Adhesin_P1_N	7e+02	11.9	Adhesin P1 N-terminal domain
2	PF01391 Collagen	2.4e-48	173.0	Collagen triple helix repeat (20 copies)
3	PF00362 Integrin_beta	8.3e+02	11.1	Integrin beta chain VWA domain
4	PF00092 VWA	3.8e-86	299.3	von Willebrand factor type A domain
5	PF13519 VWA_2	3.4e-32	122.7	von Willebrand factor type A domain
6	PF13768 VWA_3	0.00027	32.4	von Willebrand factor type A domain
7	PF05762 VWA_CoxE	22	15.9	VWA domain containing CoxE-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300527	0.996	Collagen alpha-2(VI) chain
2	9606.ENSP00000295550	0.989	Collagen alpha-3(VI) chain
3	9606.ENSP00000351310	0.961	Collagen alpha-6(VI) chain
4	9606.ENSP00000225964	0.956	Collagen alpha-1(I) chain
5	9606.ENSP00000052754	0.953	Decorin
6	9606.ENSP00000304408	0.943	Collagen alpha-1(III) chain
7	9606.ENSP00000297268	0.931	Collagen alpha-2(I) chain
8	9606.ENSP00000379350	0.929	Integrin beta-1
9	9606.ENSP00000261023	0.927	Integrin alpha-V
10	9606.ENSP00000296585	0.927	Integrin alpha-2
11	9606.ENSP00000282588	0.925	Integrin alpha-1
12	9606.ENSP00000384999	0.923	Prolyl 4-hydroxylase subunit alpha-2
13	9606.ENSP00000265379	0.919	Collagen alpha-5(VI) chain
14	9606.ENSP00000452786	0.919	Integrin beta-3
15	9606.ENSP00000401749	0.915	Prolyl 4-hydroxylase subunit alpha-3
16	9606.ENSP00000263556	0.914	Prolyl 4-hydroxylase subunit alpha-1
17	9606.ENSP00000370542	0.907	Syndecan-1
18	9606.ENSP00000351273	0.901	Caspase-8
19	9606.ENSP00000360882	0.893	Collagen alpha-1(V) chain
20	9606.ENSP00000231061	0.870	SPARC

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	1.000	growth factor binding
GO:0005518	1.000	collagen binding
GO:0048407	0.788	platelet-derived growth factor binding
GO:0005198	0.715	structural molecule activity
GO:0005201	0.532	extracellular matrix structural constituent

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0048856	0.986	anatomical structure development
GO:0032501	0.985	multicellular organismal process
GO:0007275	0.939	multicellular organism development
GO:0050896	0.837	response to stimulus
GO:0009653	0.784	anatomical structure morphogenesis
GO:0009888	0.733	tissue development
GO:0007492	0.668	endoderm development
GO:0007369	0.634	gastrulation
GO:0065007	0.598	biological regulation
GO:0050789	0.563	regulation of biological process
GO:0001704	0.538	formation of primary germ layer
GO:0030154	0.505	cell differentiation
GO:0051716	0.482	cellular response to stimulus
GO:0042221	0.479	response to chemical
GO:0001503	0.471	ossification
GO:0050794	0.465	regulation of cellular process
GO:0001706	0.389	endoderm formation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005886	0.992	plasma membrane
GO:0005615	0.991	extracellular space
GO:0043227	0.982	membrane-bounded organelle
GO:0005737	0.977	cytoplasm
GO:0043229	0.977	intracellular organelle
GO:0032991	0.973	protein-containing complex
GO:0012505	0.969	endomembrane system
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0070013	0.962	intracellular organelle lumen
GO:0031982	0.904	vesicle
GO:0043230	0.897	extracellular organelle
GO:0065010	0.894	extracellular membrane-bounded organelle
GO:0070062	0.871	extracellular exosome
GO:0005788	0.835	endoplasmic reticulum lumen
GO:0031090	0.454	organelle membrane
GO:0098588	0.409	bounding membrane of organelle
GO:0005764	0.409	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]