StarFunc result for job id P12111

User Input

>input (1400 residues)
MRKHRHLPLVAVFCLFLSGFPTTHAQQQQADVKNGAAADIIFLVDSSWTIGEEHFQLVRE
FLYDVVKSLAVGENDFHFALVQFNGNPHTEFLLNTYRTKQEVLSHISNMSYIGGTNQTGK
GLEYIMQSHLTKAAGSRAGDGVPQVIVVLTDGHSKDGLALPSAELKSADVNVFAIGVEDA
DEGALKEIASEPLNMHMFNLENFTSLHDIVGNLVSCVHSSVSPERAGDTETLKDITAQDS
ADIIFLIDGSNNTGSVNFAVILDFLVNLLEKLPIGTQQIRVGVVQFSDEPRTMFSLDTYS
TKAQVLGAVKALGFAGGELANIGLALDFVVENHFTRAGGSRVEEGVPQVLVLISAGPSSD
EIRYGVVALKQASVFSFGLGAQAASRAELQHIATDDNLVFTVPEFRSFGDLQEKLLPYIV
GVAQRHIVLKPPTIVTQVIEVNKRDIVFLVDGSSALGLANFNAIRDFIAKVIQRLEIGQD
LIQVAVAQYADTVRPEFYFNTHPTKREVITAVRKMKPLDGSALYTGSALDFVRNNLFTSS
AGYRAAEGIPKLLVLITGGKSLDEISQPAQELKRSSIMAFAIGNKGADQAELEEIAFDSS
LVFIPAEFRAAPLQGMLPGLLAPLRTLSGTPEVHSNKRDIIFLLDGSANVGKTNFPYVRD
FVMNLVNSLDIGNDNIRVGLVQFSDTPVTEFSLNTYQTKSDILGHLRQLQLQGGSGLNTG
SALSYVYANHFTEAGGSRIREHVPQLLLLLTAGQSEDSYLQAANALTRAGILTFCVGASQ
ANKAELEQIAFNPSLVYLMDDFSSLPALPQQLIQPLTTYVSGGVEEVPLAQPESKRDILF
LFDGSANLVGQFPVVRDFLYKIIDELNVKPEGTRIAVAQYSDDVKVESRFDEHQSKPEIL
NLVKRMKIKTGKALNLGYALDYAQRYIFVKSAGSRIEDGVLQFLVLLVAGRSSDRVDGPA
SNLKQSGVVPFIFQAKNADPAELEQIVLSPAFILAAESLPKIGDLHPQIVNLLKSVHNGA
PAPVSGEKDVVFLLDGSEGVRSGFPLLKEFVQRVVESLDVGQDRVRVAVVQYSDRTRPEF
YLNSYMNKQDVVNAVRQLTLLGGPTPNTGAALEFVLRNILVSSAGSRITEGVPQLLIVLT
ADRSGDDVRNPSVVVKRGGAVPIGIGIGNADITEMQTISFIPDFAVAIPTFRQLGTVQQV
ISERVTQLTREELSRLQPVLQPLPSPGVGGKRDVVFLIDGSQSAGPEFQYVRTLIERLVD
YLDVGFDTTRVAVIQFSDDPKVEFLLNAHSSKDEVQNAVQRLRPKGGRQINVGNALEYVS
RNIFKRPLGSRIEEGVPQFLVLISSGKSDDEVDDPAVELKQFGVAPFTIARNADQEELVK
ISLSPEYVFSVSTFRELPSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AX52	0.227	0.153	0.000	2309	0.278	0.168	A2AX52.pdb.gz	CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2
2	AFDB:A6NMZ7	0.253	0.190	0.000	2263	0.266	0.164	A6NMZ7.pdb.gz	CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2
3	AFDB:Q8C6K9	0.249	0.187	0.000	2265	0.263	0.162	Q8C6K9.pdb.gz	CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus OX=10090 GN=Col6a6 PE=1 SV=2
4	AFDB:X1WEZ4	0.153	0.125	0.000	1756	0.262	0.209	X1WEZ4.pdb.gz
5	AFDB:A6H584	0.249	0.172	3.949E-101	2640	0.245	0.130	A6H584.pdb.gz	CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus OX=10090 GN=Col6a5 PE=1 SV=4
6	AFDB:A8TX70	0.245	0.170	1.221E-100	2615	0.243	0.130	A8TX70.pdb.gz	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
7	AFDB:F6NRG0	0.281	0.404	1.806E-86	824	0.221	0.375	F6NRG0.pdb.gz
8	AFDB:O97267	0.159	0.117	2.550E-65	2114	0.161	0.106	O97267.pdb.gz	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
9	AFDB:U3JA51	0.148	0.248	2.538E-41	795	0.125	0.220	U3JA51.pdb.gz	U3JA51_DANRE von Willebrand factor A domain-containing 2 OS=Danio rerio OX=7955 GN=vwa2 PE=1 SV=1
10	AFDB:Q70UZ7	0.141	0.227	1.207E-40	791	0.114	0.201	Q70UZ7.pdb.gz	VWA2_MOUSE von Willebrand factor A domain-containing protein 2 OS=Mus musculus OX=10090 GN=Vwa2 PE=1 SV=1
11	PDB:4nehA	0.117	0.150	1.631E-9	1084	0.040	0.052	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nenA	0.115	0.150	7.751E-9	1063	0.033	0.043	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:6jp8F	0.118	0.166	1.425E-6	973	0.028	0.040	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
14	PDB:2xwbF	0.118	0.225	1.503E-6	714	0.024	0.048	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
15	PDB:6gym6	0.113	0.423	1.674E-6	335	0.024	0.101	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
16	PDB:7zs96	0.114	0.377	3.553E-6	383	0.021	0.076	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
17	PDB:7ena2	0.117	0.390	9.866E-6	385	0.021	0.075	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:6orbA	0.117	0.050	1.159E-5	3352	0.026	0.011	6orbA.pdb.gz
19	PDB:7ad8D	0.108	0.477	1.223E-5	280	0.017	0.086	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
20	PDB:2b3xA	0.076	0.105	3.219E-5	888	0.065	0.102	2b3xA.pdb.gz	Crystal structure of human iron regulatory protein 1 as cytosolic aconitase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WS16	0.0	1084	2677	0.396	0.207	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
2	A0A8I5ZTR6	0.0	1941	3109	0.685	0.308	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
3	A0A8I6ADR1	0.0	1071	2708	0.387	0.200	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
4	A0A8I6AHL9	0.0	2327	3316	0.820	0.346	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
5	D3YWD1	0.0	2324	1703	0.820	0.674	D3YWD1_MOUSE Collagen, type VI, alpha 3 (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
6	E9PWQ3	0.0	2318	3284	0.820	0.350	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
7	J3QQ16	0.0	1084	2677	0.396	0.207	J3QQ16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
8	O88493	0.0	1068	2657	0.388	0.204	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
9	P12111	0.0	2811	3177	1.000	0.441	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
10	Q9Z0I9	0.0	2318	1703	0.818	0.672	Q9Z0I9_MOUSE Collagen alpha3(VI) (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
11	A2AX52	2.51e-152	513	2309	0.266	0.161	CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2
12	A6NMZ7	2.40e-138	472	2263	0.244	0.151	CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2
13	Q8C6K9	5.41e-129	444	2265	0.244	0.151	CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus OX=10090 GN=Col6a6 PE=1 SV=2
14	A0A287BK35	1.95e-119	416	2337	0.229	0.137	A0A287BK35_PIG Collagen type VI alpha 5 chain OS=Sus scrofa OX=9823 GN=COL6A5 PE=1 SV=2
15	A8TX70	1.35e-118	414	2615	0.231	0.124	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
16	A6H584	1.71e-109	386	2640	0.236	0.125	CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus OX=10090 GN=Col6a5 PE=1 SV=4
17	O88494	6.28e-108	341	200	0.116	0.810	O88494_MOUSE Type VI collagen alpha 3 subunit N7 domain (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
18	Q8VHI5	2.66e-49	189	650	0.083	0.178	VITRN_MOUSE Vitrin OS=Mus musculus OX=10090 GN=Vit PE=1 SV=2
19	P21941	2.04e-39	156	496	0.086	0.244	MATN1_HUMAN Cartilage matrix protein OS=Homo sapiens OX=9606 GN=MATN1 PE=1 SV=1
20	A5WWJ4	2.46e-39	156	489	0.082	0.235	A5WWJ4_DANRE Cartilage matrix protein precursor OS=Danio rerio OX=7955 GN=matn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00092 VWA	2.7e-288	957.6	von Willebrand factor type A domain
2	PF13519 VWA_2	3.3e-80	277.1	von Willebrand factor type A domain
3	PF13768 VWA_3	3.3e-17	74.3	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300527	0.990	Collagen alpha-2(VI) chain
2	9606.ENSP00000355180	0.989	Collagen alpha-1(VI) chain
3	9606.ENSP00000379350	0.946	Integrin beta-1
4	9606.ENSP00000401749	0.927	Prolyl 4-hydroxylase subunit alpha-3
5	9606.ENSP00000265379	0.920	Collagen alpha-5(VI) chain
6	9606.ENSP00000384999	0.918	Prolyl 4-hydroxylase subunit alpha-2
7	9606.ENSP00000297268	0.917	Collagen alpha-2(I) chain
8	9606.ENSP00000282588	0.916	Integrin alpha-1
9	9606.ENSP00000351310	0.916	Collagen alpha-6(VI) chain
10	9606.ENSP00000452786	0.916	Integrin beta-3
11	9606.ENSP00000261023	0.915	Integrin alpha-V
12	9606.ENSP00000296585	0.915	Integrin alpha-2
13	9606.ENSP00000263556	0.911	Prolyl 4-hydroxylase subunit alpha-1
14	9606.ENSP00000370542	0.907	Syndecan-1
15	9606.ENSP00000304408	0.900	Collagen alpha-1(III) chain
16	9606.ENSP00000351273	0.900	Caspase-8
17	9606.ENSP00000225964	0.880	Collagen alpha-1(I) chain
18	9606.ENSP00000052754	0.866	Decorin
19	9606.ENSP00000266718	0.816	Lumican
20	9606.ENSP00000364000	0.801	Collagen alpha-2(V) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.898	anatomical structure development
GO:0061061	0.647	muscle structure development
GO:0009987	0.416	cellular process
GO:0050896	0.384	response to stimulus
GO:0048513	0.362	animal organ development
GO:0032501	0.348	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0031012	0.999	extracellular matrix
GO:0032991	0.994	protein-containing complex
GO:0005615	0.990	extracellular space
GO:0016020	0.924	membrane
GO:0005581	0.874	collagen trimer
GO:0005886	0.797	plasma membrane
GO:0062023	0.753	collagen-containing extracellular matrix
GO:0043227	0.745	membrane-bounded organelle
GO:0043231	0.637	intracellular membrane-bounded organelle
GO:0005737	0.630	cytoplasm
GO:0012505	0.610	endomembrane system
GO:0043233	0.513	organelle lumen
GO:0031982	0.372	vesicle
GO:0070013	0.368	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]