StarFunc result for job id P12236

User Input

>input (298 residues)
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05141	0.997	0.997	4.448E-38	298	0.919	0.919	P05141.pdb.gz	ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7
2	AFDB:A0A0S2Z3H3	0.993	0.993	6.372E-36	298	0.883	0.883	A0A0S2Z3H3.pdb.gz	A0A0S2Z3H3_HUMAN ADP/ATP translocase (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A4 PE=2 SV=1
3	AFDB:Q26365	0.983	0.939	1.129E-34	312	0.795	0.760	Q26365.pdb.gz	ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster OX=7227 GN=sesB PE=2 SV=4
4	PDB:2c3eA	0.953	0.969	5.333E-32	293	0.879	0.894	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
5	AFDB:Q9H0C2	0.968	0.916	6.805E-32	315	0.708	0.670	Q9H0C2.pdb.gz	ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens OX=9606 GN=SLC25A31 PE=1 SV=1
6	AFDB:Q3V132	0.961	0.895	1.853E-31	320	0.691	0.644	Q3V132.pdb.gz	ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus OX=10090 GN=Slc25a31 PE=1 SV=1
7	AFDB:O01813	0.951	0.945	3.907E-30	300	0.644	0.640	O01813.pdb.gz	O01813_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.2 PE=1 SV=1
8	AFDB:G5EFU2	0.966	0.920	4.452E-30	313	0.691	0.658	G5EFU2.pdb.gz	G5EFU2_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.4 PE=1 SV=1
9	AFDB:O97470	0.920	0.888	2.255E-27	309	0.674	0.650	O97470.pdb.gz	ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum OX=44689 GN=ancA PE=1 SV=1
10	AFDB:Q5A516	0.905	0.896	2.515E-23	301	0.544	0.538	Q5A516.pdb.gz	Q5A516_CANAL ADP/ATP translocase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PET9 PE=3 SV=1
11	AFDB:Q388C4	0.898	0.872	5.754E-23	307	0.523	0.508	Q388C4.pdb.gz	Q388C4_TRYB2 ADP/ATP translocase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1810 PE=3 SV=1
12	PDB:4c9qB	0.897	0.921	4.762E-21	290	0.523	0.538	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:6gciA	0.572	0.582	8.672E-15	292	0.517	0.527	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.541	0.542	8.825E-4	297	0.258	0.259	2lckA.pdb.gz
15	PDB:7lciR	0.166	0.139	3.155E-1	393	0.117	0.089	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
16	PDB:5do7B	0.226	0.158	4.470E-1	562	0.114	0.060	5do7B.pdb.gz
17	PDB:1fx8A	0.209	0.236	7.539E-1	254	0.104	0.122	1fx8A.pdb.gz	Structure of a glycerol-conducting channel and the basis for its selectivity.
18	PDB:7d3sR	0.165	0.177	7.539E-1	266	0.128	0.143	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
19	PDB:7o3vI	0.139	0.170	8.225E-1	193	0.087	0.135	7o3vI.pdb.gz
20	PDB:7ehlA	0.156	0.106	9.373E-1	563	0.148	0.078	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3H3	0.0	555	298	0.883	0.883	A0A0S2Z3H3_HUMAN ADP/ATP translocase (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A4 PE=2 SV=1
2	P02722	0.0	561	298	0.893	0.893	ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus OX=9913 GN=SLC25A4 PE=1 SV=3
3	P05141	0.0	573	298	0.919	0.919	ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7
4	P12235	0.0	555	298	0.883	0.883	ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens OX=9606 GN=SLC25A4 PE=1 SV=4
5	P12236	0.0	609	298	1.000	1.000	ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4
6	P48962	0.0	560	298	0.889	0.889	ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4
7	P51881	0.0	570	298	0.909	0.909	ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3
8	Q05962	0.0	561	298	0.896	0.896	ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus OX=10116 GN=Slc25a4 PE=1 SV=3
9	Q09073	0.0	572	298	0.913	0.913	ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus OX=10116 GN=Slc25a5 PE=1 SV=3
10	Q5ZMJ6	0.0	558	298	0.883	0.883	Q5ZMJ6_CHICK ADP/ATP translocase OS=Gallus gallus OX=9031 GN=SLC25A4 PE=1 SV=1
11	Q6I9V5	0.0	609	298	1.000	1.000	Q6I9V5_HUMAN ADP/ATP translocase OS=Homo sapiens OX=9606 GN=SLC25A6 PE=2 SV=1
12	Q26365	1.02e-177	494	312	0.795	0.760	ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster OX=7227 GN=sesB PE=2 SV=4
13	Q3V132	8.47e-158	444	320	0.695	0.647	ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus OX=10090 GN=Slc25a31 PE=1 SV=1
14	Q9H0C2	1.44e-157	444	315	0.708	0.670	ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens OX=9606 GN=SLC25A31 PE=1 SV=1
15	O45865	8.27e-145	410	300	0.678	0.673	O45865_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.1 PE=1 SV=1
16	G5EFU2	1.11e-144	411	313	0.695	0.661	G5EFU2_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.4 PE=1 SV=1
17	O01813	1.18e-137	392	300	0.651	0.647	O01813_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.2 PE=1 SV=1
18	O97470	3.50e-137	392	309	0.678	0.654	ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum OX=44689 GN=ancA PE=1 SV=1
19	Q59EP7	5.44e-107	313	261	0.493	0.563	Q59EP7_HUMAN ADP/ATP translocase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
20	Q5A516	2.82e-103	305	301	0.544	0.538	Q5A516_CANAL ADP/ATP translocase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PET9 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15993 Fuseless	40	14.9	Fuseless
2	PF00153 Mito_carr	1.9e-65	228.2	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000027561

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000011311	0.881	ATP synthase subunit beta
2	9593.ENSGGOP00000021335	0.839	Cytochrome c-1
3	9593.ENSGGOP00000016160	0.797	ATP synthase subunit alpha
4	9593.ENSGGOP00000020301	0.797	Belongs to the ATPase alpha/beta chains family.
5	9593.ENSGGOP00000010182	0.787	Solute carrier family 25 (mitochondrial carrier
6	9593.ENSGGOP00000015494	0.780	Solute carrier family 25 (mitochondrial carrier
7	9593.ENSGGOP00000019369	0.780	RAB28, member RAS oncogene family
8	9593.ENSGGOP00000012130	0.745	Translocase of inner mitochondrial membrane 10 homolog (yeast)
9	9593.ENSGGOP00000015011	0.732	Ubiquinol-cytochrome c reductase core protein II
10	9593.ENSGGOP00000022470	0.696	[Cytochrome b-c1 complex subunit Rieske, mitochondrial]: Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b- c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemica [...]
11	9593.ENSGGOP00000020769	0.677	SRSF protein kinase 1
12	9593.ENSGGOP00000023109	0.671	Uncharacterized protein
13	9593.ENSGGOP00000028086	0.671	Uncharacterized protein
14	9593.ENSGGOP00000007981	0.664	Ribosomal protein L8
15	9593.ENSGGOP00000022736	0.664	Citrate synthase
16	9593.ENSGGOP00000001092	0.655	Belongs to the aconitase/IPM isomerase family.
17	9593.ENSGGOP00000020946	0.655	Acetylserotonin O-methyltransferase-like
18	9593.ENSGGOP00000019513	0.653	Whirlin
19	9593.ENSGGOP00000002902	0.647	Uncharacterized protein
20	9593.ENSGGOP00000026235	0.637	Isocitrate dehydrogenase [NAD] subunit, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008514	0.999	organic anion transmembrane transporter activity
GO:0000295	0.996	adenine nucleotide transmembrane transporter activity
GO:1901702	0.976	salt transmembrane transporter activity
GO:0015291	0.955	secondary active transmembrane transporter activity
GO:1901505	0.910	carbohydrate derivative transmembrane transporter activity
GO:0005346	0.901	purine ribonucleotide transmembrane transporter activity
GO:0005347	0.847	ATP transmembrane transporter activity
GO:0015217	0.611	ADP transmembrane transporter activity
GO:0015297	0.565	antiporter activity
GO:0097159	0.509	organic cyclic compound binding
GO:1901363	0.491	heterocyclic compound binding
GO:0003676	0.431	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.928	regulation of biological process
GO:0050794	0.918	regulation of cellular process
GO:0007005	0.906	mitochondrion organization
GO:0006839	0.853	mitochondrial transport
GO:0090559	0.788	regulation of membrane permeability
GO:0071705	0.731	nitrogen compound transport
GO:0071702	0.724	organic substance transport
GO:0015748	0.603	organophosphate ester transport
GO:0061024	0.602	membrane organization
GO:0008152	0.559	metabolic process
GO:0015865	0.526	purine nucleotide transport
GO:0051503	0.508	adenine nucleotide transport
GO:0044237	0.467	cellular metabolic process
GO:0007006	0.382	mitochondrial membrane organization
GO:0071704	0.379	organic substance metabolic process
GO:0048518	0.344	positive regulation of biological process
GO:0019222	0.337	regulation of metabolic process
GO:0050896	0.336	response to stimulus
GO:0046902	0.310	regulation of mitochondrial membrane permeability
GO:0031323	0.309	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.999	membrane
GO:0031975	0.986	envelope
GO:0031967	0.976	organelle envelope
GO:0031090	0.967	organelle membrane
GO:0005740	0.956	mitochondrial envelope
GO:0032991	0.953	protein-containing complex
GO:0031966	0.879	mitochondrial membrane
GO:0005743	0.872	mitochondrial inner membrane
GO:0005634	0.787	nucleus
GO:0070013	0.396	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]