StarFunc result for job id P12259

User Input

>input (2224 residues)
MFPGCPRLWVLVVLGTSWVGWGSQGTEAAQLRQFYVAAQGISWSYRPEPTNSSLNLSVTS
FKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYS
KLSEGASYLDHTFPAEKMDDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYYSHENLIE
DFNSGLIGPLLICKKGTLTEGGTQKTFDKQIVLLFAVFDESKSWSQSSSLMYTVNGYVNG
TMPDITVCAHDHISWHLLGMSSGPELFSIHFNGQVLEQNHHKVSAITLVSATSTTANMTV
GPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRRHMKRWEYFIAAEEVI
WDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILG
PIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGET
YTYKWNILEFDEPTENDAQCLTRPYYSDVDIMRDIASGLIGLLLICKSRSLDRRGIQRAA
DIEQQAVFAVFDENKSWYLEDNINKFCENPDEVKRDDPKFYESNIMSTINGYVPESITTL
GFCFDDTVQWHFCSVGTQNEILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTMDNVGT
WMLTSMNSSPRSKKLRLKFRDVKCIPDDDEDSYEIFEPPESTVMATRKMHDRLEPEDEES
DADYDYQNRLAAALGIRSFRNSSLNQEEEEFNLTALALENGTEFVSSNTDIIVGSNYSSP
SNISKFTVNNLAEPQKAPSHQQATTAGSPLRHLIGKNSVLNSSTAEHSSPYSEDPIEDPL
QPDVTGIRLLSLGAGEFKSQEHAKHKGPKVERDQAAKHRFSWMKLLAHKVGRHLSQDTGS
PSGMRPWEDLPSQDTGSPSRMRPWKDPPSDLLLLKQSNSSKILVGRWHLASEKGSYEIIQ
DTDEDTAVNNWLISPQNASRAWGESTPLANKPGKQSGHPKFPRVRHKSLQVRQDGGKSRL
KKSQFLIKTRKKKKEKHTHHAPLSPRTFHPLRSEAYNTFSERRLKHSLVLHKSNETSLPT
DLNQTLPSMDFGWIASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHS
TSDPSHRSSSPELSEMLEYDRSHKSFPTDISQMSPSSEHEVWQTVISPDLSQVTLSPELS
QTNLSPDLSHTTLSPELIQRNLSPALGQMPISPDLSHTTLSPDLSHTTLSLDLSQTNLSP
ELSQTNLSPALGQMPLSPDLSHTTLSLDFSQTNLSPELSHMTLSPELSQTNLSPALGQMP
ISPDLSHTTLSLDFSQTNLSPELSQTNLSPALGQMPLSPDPSHTTLSLDLSQTNLSPELS
QTNLSPDLSEMPLFADLSQIPLTPDLDQMTLSPDLGETDLSPNFGQMSLSPDLSQVTLSP
DISDTTLLPDLSQISPPPDLDQIFYPSESSQSLLLQEFNESFPYPDLGQMPSPSSPTLND
TFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINS
SRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTTYKKVVF
RKYLDSTFTKRDPRGEYEEHLGILGPIIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKS
SEGKTYEDDSPEWFKEDNAVQPNSSYTYVWHATERSGPESPGSACRAWAYYSAVNPEKDI
HSGLIGPLLICQKGILHKDSNMPMDMREFVLLFMTFDEKKSWYYEKKSRSSWRLTSSEMK
KSHEFHAINGMIYSLPGLKMYEQEWVRLHLLNIGGSQDIHVVHFHGQTLLENGNKQHQLG
VWPLLPGSFKTLEMKASKPGWWLLNTEVGENQRAGMQTPFLIMDRDCRMPMGLSTGIISD
SQIKASEFLGYWEPRLARLNNGGSYNAWSVEKLAAEFASKPWIQVDMQKEVIITGIQTQG
AKHYLKSCYTTEFYVAYSSNQINWQIFKGNSTRNVMYFNGNSDASTIKENQFDPPIVARY
IRISPTRAYNRPTLRLELQGCEVNGCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFR
ARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQ
GVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSIALRLELFG
CDIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4bxsV	0.531	0.920	0.000	1262	0.344	0.607	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
2	PDB:7kveB	0.573	0.916	0.000	1374	0.617	0.999	7kveB.pdb.gz
3	AFDB:P00451	0.562	0.532	0.000	2351	0.309	0.293	P00451.pdb.gz	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
4	AFDB:P12259	1.000	1.000	0.000	2224	1.000	1.000	P12259.pdb.gz	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
5	AFDB:Q58L90	0.592	0.894	0.000	1460	0.361	0.550	Q58L90.pdb.gz	FA5V_OXYMI Venom prothrombin activator omicarin-C non-catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
6	AFDB:Q90X47	0.595	0.628	0.000	2101	0.378	0.400	Q90X47.pdb.gz
7	PDB:5n4lA	0.411	0.861	6.121E-88	1034	0.163	0.350	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
8	PDB:1kcwA	0.399	0.851	8.084E-86	1017	0.165	0.360	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.
9	PDB:2dv6A	0.103	0.480	2.352E-20	422	0.037	0.197	2dv6A.pdb.gz	Structure and function of a hexameric copper-containing nitrite reductase.
10	PDB:5lwxA	0.096	0.353	3.106E-18	554	0.029	0.117	5lwxA.pdb.gz	Structure and function of Aspergillus niger laccase McoG
11	PDB:3fu7B	0.103	0.368	2.958E-17	559	0.035	0.140	3fu7B.pdb.gz	Structure Function Studies of a Melanocarpus albomyces Laccase Suggest a Pathway for Oxidation of Phenolic Compounds.
12	PDB:3divA	0.098	0.390	6.270E-17	499	0.030	0.132	3divA.pdb.gz	Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.
13	PDB:2uxtA	0.100	0.464	7.771E-17	422	0.029	0.154	2uxtA.pdb.gz
14	PDB:3qqxA	0.096	0.398	4.101E-16	474	0.032	0.152	3qqxA.pdb.gz	CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
15	AFDB:Q6WRH9	0.037	0.034	1.279E-7	2597	0.109	0.094	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
16	AFDB:Q8TEP8	0.041	0.038	1.586E-7	2537	0.113	0.099	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
17	AFDB:Q6WRI0	0.049	0.045	1.965E-7	2623	0.116	0.098	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
18	AFDB:A2VDJ0	0.040	0.049	3.185E-7	1609	0.092	0.127	A2VDJ0.pdb.gz	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
19	AFDB:E7F5U2	0.046	0.043	9.316E-7	2497	0.105	0.094	E7F5U2.pdb.gz
20	AFDB:Q3V1M1	0.043	0.039	9.362E-6	2594	0.110	0.094	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3W2	0.0	3053	2259	0.698	0.687	A0A0G2K3W2_RAT Coagulation factor V OS=Rattus norvegicus OX=10116 GN=F5 PE=1 SV=2
2	B7ZVT7	0.0	724	2087	0.160	0.170	B7ZVT7_DANRE Coagulation factor V OS=Danio rerio OX=7955 GN=si:bz20i5.3 PE=2 SV=1
3	O88783	0.0	3095	2183	0.705	0.719	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
4	P12259	0.0	4623	2224	1.000	1.000	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
5	Q58L90	0.0	830	1460	0.184	0.281	FA5V_OXYMI Venom prothrombin activator omicarin-C non-catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
6	Q58L91	0.0	823	1459	0.186	0.284	FA5V_OXYSU Venom prothrombin activator oscutarin-C non-catalytic subunit OS=Oxyuranus scutellatus OX=8668 PE=1 SV=1
7	Q7SZN0	0.0	817	1460	0.182	0.277	FA5V_PSETE Venom prothrombin activator pseutarin-C non-catalytic subunit OS=Pseudonaja textilis OX=8673 PE=1 SV=1
8	Q7TPK2	0.0	1823	2102	0.453	0.480	Q7TPK2_RAT Ac2-120 OS=Rattus norvegicus OX=10116 GN=F5 PE=1 SV=1
9	P00451	2.81e-158	546	2351	0.130	0.123	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
10	Q7TN96	1.17e-155	538	2258	0.131	0.129	Q7TN96_RAT Factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=2 SV=1
11	D3ZEB1	3.92e-155	536	2258	0.132	0.130	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4
12	Q7ZU12	1.81e-136	459	1087	0.117	0.240	Q7ZU12_DANRE Ceruloplasmin OS=Danio rerio OX=7955 GN=wu:fi23f10 PE=1 SV=1
13	Q6MZM0	3.56e-129	440	1159	0.130	0.249	HPHL1_HUMAN Ferroxidase HEPHL1 OS=Homo sapiens OX=9606 GN=HEPHL1 PE=1 SV=2
14	Q9Z0Z4	5.78e-121	416	1157	0.113	0.217	HEPH_MOUSE Hephaestin OS=Mus musculus OX=10090 GN=Heph PE=1 SV=3
15	Q920H8	3.62e-119	410	1157	0.112	0.215	HEPH_RAT Hephaestin OS=Rattus norvegicus OX=10116 GN=Heph PE=1 SV=1
16	P13635	4.36e-117	402	1059	0.102	0.214	CERU_RAT Ceruloplasmin OS=Rattus norvegicus OX=10116 GN=Cp PE=1 SV=3
17	Q9BQS7	1.00e-116	403	1158	0.109	0.210	HEPH_HUMAN Hephaestin OS=Homo sapiens OX=9606 GN=HEPH PE=1 SV=3
18	Q1L857	4.58e-116	397	1006	0.107	0.238	Q1L857_HUMAN Ceruloplasmin (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
19	A5PL27	1.39e-115	397	1065	0.107	0.224	A5PL27_HUMAN CP protein OS=Homo sapiens OX=9606 GN=CP PE=2 SV=1
20	P00450	1.39e-115	397	1065	0.107	0.224	CERU_HUMAN Ceruloplasmin OS=Homo sapiens OX=9606 GN=CP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07731 Cu-oxidase_2	0.17	23.0	Multicopper oxidase
2	PF07732 Cu-oxidase_3	5.2e-23	92.7	Multicopper oxidase
3	PF00754 F5_F8_type_C	2.1e-51	184.8	F5/8 type C domain
4	PF06049 LSPR	4.2e-06	36.5	Coagulation Factor V LSPD Repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356771

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308541	0.990	Prothrombin
2	9606.ENSP00000356671	0.972	Antithrombin-III
3	9606.ENSP00000377783	0.972	Vitamin K-dependent protein S
4	9606.ENSP00000334145	0.958	Tissue factor
5	9606.ENSP00000234071	0.948	Vitamin K-dependent protein C
6	9606.ENSP00000364709	0.941	Coagulation factor X
7	9606.ENSP00000215727	0.937	Heparin cofactor 2
8	9606.ENSP00000333203	0.925	Plasma serine protease inhibitor
9	9606.ENSP00000415786	0.907	Glia-derived nexin
10	9606.ENSP00000222547	0.900	BET1 homolog
11	9606.ENSP00000259400	0.900	Syntaxin-17
12	9606.ENSP00000390783	0.900	Sec1 family domain-containing protein 1
13	9606.ENSP00000378431	0.832	Multimerin-1
14	9606.ENSP00000386651	0.798	Multiple coagulation factor deficiency protein 2
15	9606.ENSP00000366307	0.773	Thrombomodulin
16	9606.ENSP00000365777	0.740	Methylenetetrahydrofolate reductase
17	9606.ENSP00000251047	0.732	Protein ERGIC-53
18	9606.ENSP00000336829	0.723	Fibrinogen gamma chain
19	9606.ENSP00000356382	0.715	Coagulation factor XIII B chain
20	9606.ENSP00000306361	0.694	Fibrinogen alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.662	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0065007	0.989	biological regulation
GO:0007599	0.970	hemostasis
GO:0051604	0.962	protein maturation
GO:0032501	0.941	multicellular organismal process
GO:0050817	0.895	coagulation
GO:0042060	0.893	wound healing
GO:0007596	0.869	blood coagulation
GO:0006508	0.815	proteolysis
GO:0016485	0.627	protein processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0030141	0.999	secretory granule
GO:0016020	0.996	membrane
GO:0005783	0.994	endoplasmic reticulum
GO:0005886	0.992	plasma membrane
GO:0070013	0.992	intracellular organelle lumen
GO:0031090	0.977	organelle membrane
GO:0065010	0.965	extracellular membrane-bounded organelle
GO:0098588	0.964	bounding membrane of organelle
GO:1903561	0.961	extracellular vesicle
GO:0031091	0.958	platelet alpha granule
GO:0005615	0.955	extracellular space
GO:0005788	0.938	endoplasmic reticulum lumen
GO:0030134	0.937	COPII-coated ER to Golgi transport vesicle
GO:0034774	0.937	secretory granule lumen
GO:0005793	0.920	endoplasmic reticulum-Golgi intermediate compartment
GO:0005794	0.747	Golgi apparatus
GO:0070062	0.687	extracellular exosome
GO:0031093	0.646	platelet alpha granule lumen
GO:0033116	0.628	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0030659	0.565	cytoplasmic vesicle membrane
GO:0032991	0.419	protein-containing complex
GO:0005789	0.338	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]