StarFunc result for job id P12268

User Input

>input (514 residues)
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384N6C2	0.998	0.998	0.000	514	1.000	1.000	A0A384N6C2.pdb.gz	A0A384N6C2_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH PE=2 SV=1
2	AFDB:H0Y4R1	0.979	0.936	0.000	538	1.000	0.955	H0Y4R1.pdb.gz	H0Y4R1_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
3	AFDB:Q6GMG5	0.990	0.936	2.230E-103	544	0.850	0.803	Q6GMG5.pdb.gz	IMDH1_DANRE Inosine-5'-monophosphate dehydrogenase 1a OS=Danio rerio OX=7955 GN=impdh1a PE=2 SV=1
4	AFDB:E7ETK5	0.918	0.964	3.535E-99	489	0.951	1.000	E7ETK5.pdb.gz	E7ETK5_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
5	PDB:7rfgA	0.943	0.986	4.587E-92	491	0.802	0.839	7rfgA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
6	AFDB:Q07152	0.954	0.913	3.049E-88	537	0.677	0.648	Q07152.pdb.gz	IMDH_DROME Inosine-5'-monophosphate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=ras PE=1 SV=1
7	PDB:6i0mA	0.862	0.984	8.655E-87	450	0.874	0.998	6i0mA.pdb.gz	A Nucleotide-Dependent Conformational Switch Controls the Polymerization of Human IMP Dehydrogenases to Modulate their Catalytic Activity.
8	AFDB:P38697	0.960	0.944	3.839E-86	523	0.605	0.595	P38697.pdb.gz	IMDH2_YEAST Inosine-5'-monophosphate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD2 PE=1 SV=1
9	AFDB:P50094	0.958	0.940	1.677E-85	524	0.617	0.605	P50094.pdb.gz	IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD4 PE=1 SV=1
10	AFDB:Q59Q46	0.960	0.947	4.569E-85	521	0.634	0.626	Q59Q46.pdb.gz	IMDH_CANAL Inosine-5'-monophosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IMH3 PE=1 SV=2
11	PDB:6uajA	0.933	0.980	9.131E-85	489	0.949	0.998	6uajA.pdb.gz	Cryo-EM structures demonstrate human IMPDH2 filament assembly tunes allosteric regulation.
12	AFDB:Q6FM59	0.958	0.934	9.271E-85	527	0.611	0.596	Q6FM59.pdb.gz	Q6FM59_CANGA Inosine-5'-monophosphate dehydrogenase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K10780g PE=3 SV=1
13	AFDB:Q54QQ0	0.944	0.942	6.491E-84	515	0.593	0.592	Q54QQ0.pdb.gz	IMDH_DICDI Inosine-5'-monophosphate dehydrogenase OS=Dictyostelium discoideum OX=44689 GN=impdh PE=1 SV=1
14	PDB:1nf7A	0.746	0.836	3.515E-81	454	0.881	0.998	1nf7A.pdb.gz	Crystal Structure of Human Inosine Monophosphate Dehydrogenase type II complexed with the MPA/NAD analog C2-MAD
15	PDB:1b3oB	0.633	0.790	9.321E-71	410	0.796	0.998	1b3oB.pdb.gz	Crystal structure of human type II inosine monophosphate dehydrogenase: implications for ligand binding and drug design.
16	PDB:7rglA	0.738	0.907	1.585E-70	416	0.693	0.856	7rglA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
17	PDB:7rerA	0.725	0.956	9.833E-69	389	0.650	0.859	7rerA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
18	PDB:7rfhH	0.733	0.827	3.374E-66	451	0.718	0.818	7rfhH.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
19	PDB:1nfbA	0.680	0.869	2.227E-65	396	0.768	0.997	1nfbA.pdb.gz	The Conformation of NAD Bound to Human Inosine Monophosphate Dehydrogenase Type II
20	PDB:6u8sA	0.704	0.960	1.555E-63	376	0.730	0.997	6u8sA.pdb.gz	Cryo-EM structures demonstrate human IMPDH2 filament assembly tunes allosteric regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A384N6C2	1055	514	1.000	1.000	A0A384N6C2_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH PE=2 SV=1
2	A0A3B3IRL5	824	509	0.768	0.776	A0A3B3IRL5_HUMAN Inosine-5'-monophosphate dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=IMPDH1 PE=1 SV=1
3	B0UXP9	978	514	0.914	0.914	IMDH2_DANRE Inosine-5'-monophosphate dehydrogenase 2 OS=Danio rerio OX=7955 GN=impdh2 PE=3 SV=1
4	C9J381	901	513	0.839	0.840	C9J381_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH1 PE=1 SV=1
5	D3ZLZ7	902	514	0.839	0.839	IMDH1_RAT Inosine-5'-monophosphate dehydrogenase 1 OS=Rattus norvegicus OX=10116 GN=Impdh1 PE=3 SV=1
6	E7ETK5	987	489	0.951	1.000	E7ETK5_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
7	E9PU28	1040	514	0.986	0.986	IMDH2_RAT Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus OX=10116 GN=Impdh2 PE=1 SV=1
8	F1DBB2	573	527	0.572	0.558	MPAF_PENBR Inosine-5'-monophosphate dehydrogenase OS=Penicillium brevicompactum OX=5074 GN=mpaF PE=3 SV=1
9	H0Y4R1	1040	538	1.000	0.955	H0Y4R1_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
10	O14344	598	524	0.580	0.569	IMDH_SCHPO Inosine-5'-monophosphate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gua1 PE=2 SV=1
11	P12268	1055	514	1.000	1.000	IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
12	P20839	907	514	0.840	0.840	IMDH1_HUMAN Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1 PE=1 SV=2
13	P24547	1042	514	0.988	0.988	IMDH2_MOUSE Inosine-5'-monophosphate dehydrogenase 2 OS=Mus musculus OX=10090 GN=Impdh2 PE=1 SV=2
14	P38697	644	523	0.605	0.595	IMDH2_YEAST Inosine-5'-monophosphate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD2 PE=1 SV=1
15	P50094	652	524	0.619	0.607	IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD4 PE=1 SV=1
16	P50095	632	523	0.615	0.604	IMDH3_YEAST Inosine-5'-monophosphate dehydrogenase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD3 PE=1 SV=1
17	P50096	903	514	0.839	0.839	IMDH1_MOUSE Inosine-5'-monophosphate dehydrogenase 1 OS=Mus musculus OX=10090 GN=Impdh1 PE=1 SV=2
18	Q07152	717	537	0.673	0.644	IMDH_DROME Inosine-5'-monophosphate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=ras PE=1 SV=1
19	Q54QQ0	613	515	0.593	0.592	IMDH_DICDI Inosine-5'-monophosphate dehydrogenase OS=Dictyostelium discoideum OX=44689 GN=impdh PE=1 SV=1
20	Q59Q46	647	521	0.644	0.635	IMDH_CANAL Inosine-5'-monophosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IMH3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01081 Aldolase	2.4e+02	12.5	KDPG and KHG aldolase
2	PF00571 CBS	5.3e-10	50.9	CBS domain
3	PF04481 DUF561	1.5e+02	13.0	Protein of unknown function (DUF561)
4	PF01207 Dus	9.7	16.8	Dihydrouridine synthase (Dus)
5	PF01070 FMN_dh	7.4e-07	40.1	FMN-dependent dehydrogenase
6	PF04309 G3P_antiterm	1.1e+02	13.6	Glycerol-3-phosphate responsive antiterminator
7	PF01645 Glu_synthase	43	14.7	Conserved region in glutamate synthase
8	PF00977 His_biosynth	0.018	26.1	Histidine biosynthesis protein
9	PF00478 IMPDH	4.4e-138	471.6	IMP dehydrogenase / GMP reductase domain
10	PF04131 NanE	0.064	23.9	Putative N-acetylmannosamine-6-phosphate epimerase
11	PF03060 NMO	1.1e-10	53.1	Nitronate monooxygenase
12	PF05690 ThiG	2.3	19.1	Thiazole biosynthesis protein ThiG

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012922

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000017828	0.998	Guanine monphosphate synthase
2	9593.ENSGGOP00000000884	0.997	5'-nucleotidase, ecto (CD73)
3	9593.ENSGGOP00000018920	0.996	5'-nucleotidase, cytosolic II
4	9593.ENSGGOP00000022787	0.988	Hypoxanthine phosphoribosyltransferase 1
5	9593.ENSGGOP00000014620	0.987	Uncharacterized protein
6	9593.ENSGGOP00000010831	0.976	Adenylosuccinate synthetase
7	9593.ENSGGOP00000013470	0.968	AMP deaminase
8	9593.ENSGGOP00000012654	0.964	Adenylosuccinate synthetase
9	9593.ENSGGOP00000013001	0.963	AMP deaminase
10	9593.ENSGGOP00000013673	0.962	AMP deaminase
11	9593.ENSGGOP00000008084	0.943	5'-nucleotidase, cytosolic IA
12	9593.ENSGGOP00000004641	0.938	5', 3'-nucleotidase, cytosolic
13	9593.ENSGGOP00000008544	0.936	Inosine triphosphate pyrophosphatase
14	9593.ENSGGOP00000005236	0.930	Ectonucleoside triphosphate diphosphohydrolase 1
15	9593.ENSGGOP00000015749	0.926	Uncharacterized protein
16	9593.ENSGGOP00000004085	0.923	GMP reductase
17	9593.ENSGGOP00000016774	0.920	CTP synthase
18	9593.ENSGGOP00000007745	0.917	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
19	9593.ENSGGOP00000015758	0.912	Thiopurine S-methyltransferase
20	9593.ENSGGOP00000009886	0.905	5'-nucleotidase, cytosolic IIIB

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003938	1.000	IMP dehydrogenase activity
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:0005515	0.997	protein binding
GO:0003676	0.970	nucleic acid binding
GO:0042802	0.753	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044238	0.995	primary metabolic process
GO:1901360	0.993	organic cyclic compound metabolic process
GO:0006725	0.993	cellular aromatic compound metabolic process
GO:1901576	0.991	organic substance biosynthetic process
GO:0046483	0.991	heterocycle metabolic process
GO:0034641	0.989	cellular nitrogen compound metabolic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:0044281	0.976	small molecule metabolic process
GO:0006139	0.967	nucleobase-containing compound metabolic process
GO:0019637	0.963	organophosphate metabolic process
GO:0009165	0.947	nucleotide biosynthetic process
GO:1901566	0.935	organonitrogen compound biosynthetic process
GO:0006163	0.927	purine nucleotide metabolic process
GO:0006164	0.911	purine nucleotide biosynthetic process
GO:1901135	0.867	carbohydrate derivative metabolic process
GO:0019693	0.833	ribose phosphate metabolic process
GO:0009150	0.812	purine ribonucleotide metabolic process
GO:0046390	0.739	ribose phosphate biosynthetic process
GO:0009152	0.731	purine ribonucleotide biosynthetic process
GO:0032501	0.455	multicellular organismal process
GO:0065007	0.333	biological regulation
GO:0050896	0.313	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0070013	0.882	intracellular organelle lumen
GO:0043227	0.834	membrane-bounded organelle
GO:0043231	0.808	intracellular membrane-bounded organelle
GO:0031981	0.501	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11708	1.000	H2O + IMP + NAD(+) = H(+) + NADH + XMP
EC:1.1.1.205	1.000	IMP dehydrogenase.

[back to server]