StarFunc result for job id P12270

User Input

>input (2363 residues)
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKR
LSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEEL
EAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYRE
KRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVSRLEEQM
NGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS
NELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLEKELENANDLL
SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSS
VLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
RNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQ
MQLVDSIVRQRDMYRILLSQTTGVAIPLHASSLDDVSLASTPKRPSTSQTVSTPAPVPVI
ESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDF
ASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVR
AENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ
IEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKE
IATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTS
NVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQD
DKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQN
KYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLLECKASWEERERMLKD
EVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEIL
RFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE
ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGM
LQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKA
EIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRR
YKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENL
QKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAA
KSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQYEGRISRLERELREH
QERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPV
FGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEV
VQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLK
SVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDL
GPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDYEEDEEDDDDDEDDTG
MGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGEGNHRAADSQNSGEG
NTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR
IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAG
VPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAA
PVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAG
LEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRRVRLQTTLRQGVRGRQ
FNRQRGVSHAMGGRGGINRGNIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F6ZDS4	0.146	0.143	0.000	2431	0.938	0.912	F6ZDS4.pdb.gz	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
2	AFDB:Q5EE04	0.086	0.100	0.000	1997	0.598	0.707	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
3	AFDB:A1Z8P9	0.085	0.085	5.748E-49	2346	0.214	0.215	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
4	AFDB:A4GSN8	0.105	0.116	9.879E-32	2093	0.179	0.203	A4GSN8.pdb.gz	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
5	AFDB:O74424	0.090	0.112	2.028E-20	1837	0.156	0.200	O74424.pdb.gz	NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup211 PE=1 SV=1
6	AFDB:Q02455	0.077	0.092	2.757E-20	1875	0.156	0.196	Q02455.pdb.gz	MLP1_YEAST Protein MLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP1 PE=1 SV=2
7	AFDB:Q6VGS5	0.056	0.062	1.102E-16	2009	0.143	0.168	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
8	AFDB:P85120	0.054	0.060	9.768E-15	2058	0.137	0.157	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
9	AFDB:P40457	0.079	0.107	2.460E-12	1679	0.133	0.187	P40457.pdb.gz	MLP2_YEAST Protein MLP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP2 PE=1 SV=1
10	AFDB:A0A2R8QCI3	0.065	0.074	3.557E-12	2023	0.153	0.179	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
11	PDB:7rroP	0.044	0.189	5.623	373	0.021	0.134	7rroP.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:5b63C	0.013	0.039	9.774	553	0.005	0.022	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MA98	0.0	4183	2360	0.935	0.936	TPR_RAT Nucleoprotein TPR OS=Rattus norvegicus OX=10116 GN=Tpr PE=1 SV=1
2	F6ZDS4	0.0	4147	2431	0.931	0.905	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
3	P12270	0.0	4761	2363	1.000	1.000	TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3
4	Q5EE04	0.0	2588	1997	0.600	0.710	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
5	A1Z8P9	2.00e-98	358	2346	0.190	0.191	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
6	A4GSN8	7.49e-43	176	2093	0.178	0.201	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
7	Q02455	1.77e-26	122	1875	0.076	0.095	MLP1_YEAST Protein MLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP1 PE=1 SV=2
8	Q54JG6	2.53e-24	115	2037	0.061	0.071	Q54JG6_DICDI Nucleoprotein TPR/MLP1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288073 PE=4 SV=1
9	O74424	1.36e-18	96.3	1837	0.072	0.093	NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup211 PE=1 SV=1
10	Q9UTK5	5.95e-08	61.2	1727	0.112	0.153	ALM1_SCHPO Nucleoporin alm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alm1 PE=1 SV=1
11	Q811D2	3.52e-04	48.5	1581	0.047	0.071	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
12	P04259	4.29e-04	47.8	564	0.034	0.144	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
13	P48668	4.59e-04	47.8	564	0.034	0.144	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
14	P40457	5.45e-04	48.1	1679	0.033	0.047	MLP2_YEAST Protein MLP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP2 PE=1 SV=1
15	P04264	0.001	46.2	644	0.029	0.106	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
16	P02538	0.002	45.8	564	0.034	0.142	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
17	Q8BGZ7	0.003	45.1	551	0.033	0.143	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
18	O95678	0.004	44.7	551	0.032	0.138	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
19	P13647	0.005	44.7	590	0.031	0.125	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
20	Q8IUG5	0.027	42.4	2567	0.067	0.062	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06698 DUF1192	36	15.8	Protein of unknown function (DUF1192)
2	PF16888 DUF5082	23	16.7	Domain of unknown function (DUF5082)
3	PF02403 Seryl_tRNA_N	4.6	18.9	Seryl-tRNA synthetase N-terminal domain
4	PF07926 TPR_MLP1_2	2.9e-30	116.4	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356448

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000444029	0.999	Nuclear pore complex protein Nup153
2	9606.ENSP00000316032	0.995	Nuclear pore complex protein Nup98-Nup96
3	9606.ENSP00000385334	0.990	Mitotic spindle assembly checkpoint protein MAD1
4	9606.ENSP00000229179	0.988	Nuclear pore complex protein Nup107
5	9606.ENSP00000345895	0.986	Nuclear pore complex protein Nup50
6	9606.ENSP00000283195	0.985	E3 SUMO-protein ligase RanBP2
7	9606.ENSP00000347184	0.983	Huntingtin
8	9606.ENSP00000436679	0.983	Nuclear RNA export factor 1
9	9606.ENSP00000308622	0.982	Nucleoporin GLE1
10	9606.ENSP00000296509	0.976	Mitotic spindle assembly checkpoint protein MAD2A
11	9606.ENSP00000310668	0.973	Nuclear pore complex protein Nup93
12	9606.ENSP00000285968	0.972	Nuclear pore complex protein Nup205
13	9606.ENSP00000245544	0.970	Nuclear pore complex protein Nup85
14	9606.ENSP00000352400	0.968	Nuclear pore complex protein Nup214
15	9606.ENSP00000231498	0.967	Nuclear pore complex protein Nup155
16	9606.ENSP00000380820	0.965	Germinal-center associated nuclear protein
17	9606.ENSP00000382779	0.965	Nucleoporin SEH1
18	9606.ENSP00000458954	0.959	Nuclear pore complex protein Nup88
19	9606.ENSP00000428259	0.955	Centrin-3
20	9606.ENSP00000373312	0.950	Protein SEC13 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.938	heterocyclic compound binding
GO:0097159	0.938	organic cyclic compound binding
GO:0003676	0.925	nucleic acid binding
GO:0003723	0.832	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006913	0.992	nucleocytoplasmic transport
GO:0050794	0.989	regulation of cellular process
GO:0033036	0.983	macromolecule localization
GO:0051168	0.978	nuclear export
GO:0048518	0.977	positive regulation of biological process
GO:0048522	0.974	positive regulation of cellular process
GO:0046822	0.969	regulation of nucleocytoplasmic transport
GO:0071705	0.946	nitrogen compound transport
GO:0071702	0.946	organic substance transport
GO:0032880	0.936	regulation of protein localization
GO:0032388	0.921	positive regulation of intracellular transport
GO:0045184	0.894	establishment of protein localization
GO:0033157	0.893	regulation of intracellular protein transport
GO:0050896	0.891	response to stimulus
GO:0046824	0.878	positive regulation of nucleocytoplasmic transport
GO:0008152	0.857	metabolic process
GO:0071704	0.845	organic substance metabolic process
GO:1903829	0.843	positive regulation of protein localization
GO:0051716	0.842	cellular response to stimulus
GO:1904951	0.827	positive regulation of establishment of protein localization
GO:0015031	0.791	protein transport
GO:0043170	0.774	macromolecule metabolic process
GO:0006886	0.751	intracellular protein transport
GO:0042221	0.618	response to chemical
GO:0051222	0.562	positive regulation of protein transport
GO:0010033	0.556	response to organic substance
GO:0090316	0.508	positive regulation of intracellular protein transport
GO:0019222	0.506	regulation of metabolic process
GO:0071840	0.503	cellular component organization or biogenesis
GO:0060255	0.465	regulation of macromolecule metabolic process
GO:0031323	0.461	regulation of cellular metabolic process
GO:0080090	0.459	regulation of primary metabolic process
GO:0051171	0.455	regulation of nitrogen compound metabolic process
GO:0010468	0.447	regulation of gene expression
GO:0048519	0.446	negative regulation of biological process
GO:0044237	0.437	cellular metabolic process
GO:0010467	0.436	gene expression
GO:0016043	0.433	cellular component organization
GO:0019219	0.387	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.314	negative regulation of cellular process
GO:0051252	0.301	regulation of RNA metabolic process
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0034399	0.998	nuclear periphery
GO:0005643	0.998	nuclear pore
GO:0031090	0.987	organelle membrane
GO:0042405	0.985	nuclear inclusion body
GO:0005654	0.985	nucleoplasm
GO:0005737	0.979	cytoplasm
GO:0005829	0.936	cytosol
GO:0043232	0.926	intracellular non-membrane-bounded organelle
GO:0044615	0.864	nuclear pore nuclear basket
GO:0031965	0.763	nuclear membrane
GO:0005856	0.432	cytoskeleton
GO:0015630	0.416	microtubule cytoskeleton
GO:1902494	0.323	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]