StarFunc result for job id P12272

User Input

>input (177 residues)
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFL
HHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK
TPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RB29	0.297	0.297	2.489E-22	177	1.000	1.000	A0A024RB29.pdb.gz
2	AFDB:P13085	0.562	0.562	3.329E-20	177	0.881	0.881	P13085.pdb.gz	PTHR_RAT Parathyroid hormone-related protein OS=Rattus norvegicus OX=10116 GN=Pthlh PE=2 SV=1
3	AFDB:Q5TLZ2	0.360	0.359	2.220E-15	178	0.740	0.736	Q5TLZ2.pdb.gz	Q5TLZ2_CHICK Parathyroid hormone like hormone OS=Gallus gallus OX=9031 GN=PTHrP PE=2 SV=1
4	AFDB:Q9BW85	0.180	0.104	1.099E-2	323	0.158	0.087	Q9BW85.pdb.gz	YJU2_HUMAN Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1
5	AFDB:A8WHR3	0.191	0.106	7.350E-2	345	0.169	0.087	A8WHR3.pdb.gz	YJU2_DANRE Splicing factor YJU2 OS=Danio rerio OX=7955 GN=yju2 PE=1 SV=1
6	AFDB:Q9H6H4	0.189	0.135	1.319E-1	257	0.141	0.097	Q9H6H4.pdb.gz	REEP4_HUMAN Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4 PE=1 SV=1
7	AFDB:Q9SJW0	0.178	0.116	1.526E-1	286	0.141	0.087	Q9SJW0.pdb.gz	PHL7_ARATH Myb family transcription factor PHL7 OS=Arabidopsis thaliana OX=3702 GN=PHL7 PE=2 SV=1
8	AFDB:Q9AT61	0.137	0.102	1.642E-1	268	0.113	0.075	Q9AT61.pdb.gz	LBD13_ARATH LOB domain-containing protein 13 OS=Arabidopsis thaliana OX=3702 GN=LBD13 PE=1 SV=2
9	AFDB:Q1PDM1	0.145	0.137	1.766E-1	192	0.147	0.135	Q1PDM1.pdb.gz	Q1PDM1_ARATH Microspore-specific promoter 2 OS=Arabidopsis thaliana OX=3702 GN=MSP2 PE=2 SV=1
10	AFDB:A0A0B4K6W9	0.161	0.046	1.900E-1	898	0.136	0.027	A0A0B4K6W9.pdb.gz	A0A0B4K6W9_DROME Hephaestus, isoform Y OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
11	PDB:4n78F	0.201	0.225	1.845	156	0.090	0.103	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:7bt6r	0.150	0.118	2.472	230	0.056	0.043	7bt6r.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	PDB:4v60A	0.174	0.046	3.311	812	0.096	0.021	4v60A.pdb.gz
14	PDB:5wlcNB	0.148	0.179	4.772	142	0.068	0.085	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
15	PDB:7dvqR	0.132	0.100	5.134	241	0.119	0.087	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:6qikz	0.162	0.383	6.876	58	0.056	0.172	6qikz.pdb.gz	Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
17	PDB:5n9jG	0.147	0.157	7.398	163	0.073	0.080	5n9jG.pdb.gz
18	PDB:6tedR	0.172	0.137	7.398	244	0.051	0.037	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
19	PDB:6zqdUN	0.160	0.141	7.398	203	0.073	0.064	6zqdUN.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
20	PDB:7vciU	0.094	0.034	7.398	820	0.107	0.023	7vciU.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12272	1.41e-129	362	177	1.000	1.000	PTHR_HUMAN Parathyroid hormone-related protein OS=Homo sapiens OX=9606 GN=PTHLH PE=1 SV=1
2	Q53XY9	6.34e-128	358	175	0.989	1.000	Q53XY9_HUMAN Parathyroid hormone-related protein OS=Homo sapiens OX=9606 GN=PTHLH PE=2 SV=1
3	F5GZD9	1.11e-125	352	172	0.972	1.000	F5GZD9_HUMAN Parathyroid hormone-related protein (Fragment) OS=Homo sapiens OX=9606 GN=PTHLH PE=1 SV=1
4	P13085	1.97e-91	266	177	0.893	0.893	PTHR_RAT Parathyroid hormone-related protein OS=Rattus norvegicus OX=10116 GN=Pthlh PE=2 SV=1
5	P22858	1.60e-90	263	175	0.864	0.874	PTHR_MOUSE Parathyroid hormone-related protein OS=Mus musculus OX=10090 GN=Pthlh PE=2 SV=1
6	Q7YRI2	1.81e-89	260	170	0.853	0.888	Q7YRI2_CEREL Parathyroid hormone-related protein (Fragment) OS=Cervus elaphus OX=9860 PE=2 SV=1
7	P17251	1.70e-75	225	176	0.729	0.733	PTHR_CHICK Parathyroid hormone-related protein OS=Gallus gallus OX=9031 GN=PTHLH PE=1 SV=1
8	Q5TLZ2	2.07e-75	225	178	0.729	0.725	Q5TLZ2_CHICK Parathyroid hormone like hormone OS=Gallus gallus OX=9031 GN=PTHrP PE=2 SV=1
9	Q5SPK3	4.94e-29	108	198	0.350	0.313	Q5SPK3_DANRE Parathyroid hormone-like hormone OS=Danio rerio OX=7955 GN=pthlh PE=2 SV=1
10	Q1L5E8	5.11e-29	108	198	0.350	0.313	Q1L5E8_DANRE Parathyroid hormone-related peptide 1 OS=Danio rerio OX=7955 GN=pthrp PE=2 SV=1
11	Q1L5E7	3.24e-19	81.6	162	0.266	0.290	Q1L5E7_DANRE Parathyroid hormone-like hormone b OS=Danio rerio OX=7955 GN=pthrp2 PE=2 SV=1
12	A0A1L2F565	1.01e-07	50.4	121	0.181	0.264	PTH4_DANRE Parathyroid hormone 4 OS=Danio rerio OX=7955 GN=pth4 PE=2 SV=1
13	P01270	0.50	32.0	115	0.096	0.148	PTHY_HUMAN Parathyroid hormone OS=Homo sapiens OX=9606 GN=PTH PE=1 SV=1
14	P04089	1.9	30.0	115	0.079	0.122	PTHY_RAT Parathyroid hormone OS=Rattus norvegicus OX=10116 GN=Pth PE=2 SV=1
15	Q8R5K2	2.1	31.2	909	0.192	0.037	UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus OX=10090 GN=Usp33 PE=1 SV=2
16	Q6WQ25	2.2	29.6	102	0.136	0.235	Q6WQ25_DANRE Parathyroid hormone OS=Danio rerio OX=7955 GN=pth1 PE=2 SV=1
17	Q9Z0L6	2.3	30.0	115	0.079	0.122	Q9Z0L6_MOUSE Parathyroid hormone OS=Mus musculus OX=10090 GN=Pth PE=1 SV=1
18	F1QL52	4.6	30.4	4219	0.119	0.005	F1QL52_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
19	Q8I2H7	4.6	30.0	1056	0.107	0.018	Q8I2H7_PLAF7 DNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0934100 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15794 CCDC106	2.2e+02	13.0	Coiled-coil domain-containing protein 106
2	PF01279 Parathyroid	4.5e-31	119.1	Parathyroid hormone family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010378188.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010373067.1	0.992	Parathyroid hormone/parathyroid hormone-related peptide receptor isoform X1
2	61622.XP_010386691.1	0.944	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
3	61622.XP_010377662.1	0.937	Karyopherin subunit beta 1
4	61622.XP_010375142.1	0.877	Belongs to the G-protein coupled receptor 2 family.
5	61622.XP_010358565.1	0.755	Intercellular signal essential for a variety of patterning events during development
6	61622.XP_010372612.1	0.744	Vasoactive intestinal polypeptide receptor 1 isoform X1
7	61622.XP_010372793.1	0.638	Tumor necrosis factor superfamily member 11
8	61622.XP_010370838.1	0.604	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX
9	61622.XP_010386671.1	0.582	Calcitonin related polypeptide alpha
10	61622.XP_010351444.1	0.580	S-antigen visual arrestin
11	61622.XP_010351029.1	0.567	CAP, adenylate cyclase-associated protein, 2 (yeast)
12	61622.XP_010360452.1	0.563	Belongs to the G-protein coupled receptor 2 family.
13	61622.XP_010368048.1	0.550	Belongs to the PDGF/VEGF growth factor family.
14	61622.XP_010357334.1	0.541	Tumor necrosis factor receptor superfamily member 11B
15	61622.XP_010352456.1	0.540	Collagen type II alpha 1 chain
16	61622.XP_010377519.1	0.531	Interleukin-11
17	61622.XP_010374535.1	0.521	Sclerostin
18	61622.XP_010368831.1	0.515	Extracellular calcium-sensing receptor isoform X1
19	61622.XP_010367761.1	0.503	Parathyroid hormone 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0032502	0.994	developmental process
GO:0032501	0.994	multicellular organismal process
GO:0009987	0.987	cellular process
GO:0048523	0.986	negative regulation of cellular process
GO:0050896	0.968	response to stimulus
GO:0042127	0.968	regulation of cell population proliferation
GO:0048518	0.957	positive regulation of biological process
GO:0048856	0.956	anatomical structure development
GO:0048522	0.954	positive regulation of cellular process
GO:0051239	0.946	regulation of multicellular organismal process
GO:0050793	0.946	regulation of developmental process
GO:0045595	0.934	regulation of cell differentiation
GO:0051716	0.860	cellular response to stimulus
GO:2000026	0.851	regulation of multicellular organismal development
GO:0007165	0.835	signal transduction
GO:0007186	0.817	G protein-coupled receptor signaling pathway
GO:0061035	0.757	regulation of cartilage development
GO:0007188	0.755	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0032330	0.753	regulation of chondrocyte differentiation
GO:0001503	0.746	ossification
GO:0007275	0.682	multicellular organism development
GO:0048731	0.672	system development
GO:0019222	0.581	regulation of metabolic process
GO:0051093	0.579	negative regulation of developmental process
GO:0060255	0.549	regulation of macromolecule metabolic process
GO:0071704	0.545	organic substance metabolic process
GO:0045596	0.522	negative regulation of cell differentiation
GO:0008284	0.509	positive regulation of cell population proliferation
GO:0044238	0.490	primary metabolic process
GO:0080090	0.468	regulation of primary metabolic process
GO:0031323	0.464	regulation of cellular metabolic process
GO:0001501	0.434	skeletal system development
GO:0010468	0.431	regulation of gene expression
GO:0051171	0.417	regulation of nitrogen compound metabolic process
GO:0009888	0.409	tissue development
GO:0044237	0.406	cellular metabolic process
GO:0051241	0.370	negative regulation of multicellular organismal process
GO:0006807	0.367	nitrogen compound metabolic process
GO:0031326	0.355	regulation of cellular biosynthetic process
GO:0009893	0.354	positive regulation of metabolic process
GO:0007189	0.348	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0010556	0.324	regulation of macromolecule biosynthetic process
GO:0051252	0.316	regulation of RNA metabolic process
GO:0006355	0.314	regulation of DNA-templated transcription
GO:0030154	0.302	cell differentiation
GO:0048513	0.301	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0005794	0.995	Golgi apparatus
GO:0005576	0.971	extracellular region
GO:0005615	0.904	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]