StarFunc result for job id P12273

User Input

>input (146 residues)
MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQT
ELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIREL
GICPDDAAVIPIKNNRFYTIEILKVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12273	1.000	1.000	8.959E-26	146	1.000	1.000	P12273.pdb.gz	PIP_HUMAN Prolactin-inducible protein OS=Homo sapiens OX=9606 GN=PIP PE=1 SV=1
2	PDB:3es6B	0.780	0.961	6.459E-19	118	0.760	0.941	3es6B.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
3	AFDB:P02816	0.789	0.789	2.667E-17	146	0.452	0.452	P02816.pdb.gz	PIP_MOUSE Prolactin-inducible protein homolog OS=Mus musculus OX=10090 GN=Pip PE=2 SV=3
4	AFDB:E9PX96	0.564	0.504	6.244E-7	165	0.171	0.152	E9PX96.pdb.gz	E9PX96_MOUSE Prolactin-induced protein OS=Mus musculus OX=10090 GN=Sva PE=1 SV=1
5	PDB:7q5zA	0.642	0.078	5.467E-6	1344	0.151	0.016	7q5zA.pdb.gz
6	PDB:7q1yA	0.677	0.080	1.932E-5	1374	0.164	0.017	7q1yA.pdb.gz
7	AFDB:A8K2U0	0.637	0.072	2.257E-4	1454	0.151	0.015	A8K2U0.pdb.gz	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
8	AFDB:A0A0R4IDD1	0.639	0.073	7.179E-4	1442	0.137	0.014	A0A0R4IDD1.pdb.gz
9	AFDB:Q57XQ5	0.472	0.289	1.037E-3	266	0.089	0.049	Q57XQ5.pdb.gz	Q57XQ5_TRYB2 Translocon-associated protein subunit alpha OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.120 PE=3 SV=1
10	AFDB:Q8GYD9	0.519	0.086	1.037E-3	1002	0.110	0.016	Q8GYD9.pdb.gz	SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana OX=3702 GN=SDE3 PE=1 SV=1
11	AFDB:Q9VUZ0	0.440	0.356	1.037E-3	190	0.103	0.079	Q9VUZ0.pdb.gz	Q9VUZ0_DROME Translocon-associated protein subunit beta OS=Drosophila melanogaster OX=7227 GN=SsRbeta PE=1 SV=2
12	AFDB:Q22622	0.418	0.184	1.093E-3	419	0.123	0.043	Q22622.pdb.gz	Q22622_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=osm-10 PE=1 SV=1
13	AFDB:P20742	0.615	0.068	1.215E-3	1482	0.151	0.015	P20742.pdb.gz	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
14	PDB:1l9mB	0.538	0.131	1.368E-3	681	0.110	0.023	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
15	PDB:4ziqA	0.538	0.065	1.368E-3	1450	0.082	0.008	4ziqA.pdb.gz
16	PDB:5a42A	0.547	0.060	1.779E-3	1597	0.082	0.008	5a42A.pdb.gz
17	PDB:7p2pB	0.269	0.237	3.173E-3	179	0.185	0.151	7p2pB.pdb.gz
18	PDB:7ea3J	0.449	0.093	3.715E-3	883	0.041	0.007	7ea3J.pdb.gz
19	PDB:5jp0A	0.434	0.100	5.093E-3	745	0.089	0.017	5jp0A.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
20	PDB:7tvzE	0.509	0.129	5.093E-3	665	0.103	0.023	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12273	2.99e-105	298	146	1.000	1.000	PIP_HUMAN Prolactin-inducible protein OS=Homo sapiens OX=9606 GN=PIP PE=1 SV=1
2	P02816	2.97e-46	149	146	0.466	0.466	PIP_MOUSE Prolactin-inducible protein homolog OS=Mus musculus OX=10090 GN=Pip PE=2 SV=3
3	P36775	0.29	33.1	1133	0.144	0.019	LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIM1 PE=1 SV=2
4	A8K2U0	0.32	33.1	1454	0.123	0.012	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
5	B8QSI4	5.0	29.6	1442	0.103	0.010	B8QSI4_DANRE Alpha-2 macroglobulin-like protein OS=Danio rerio OX=7955 GN=A2ML PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05326 SVA	4.7e-49	176.9	Seminal vesicle autoantigen (SVA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291009

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292401	0.995	Zinc-alpha-2-glycoprotein
2	9606.ENSP00000011653	0.980	T-cell surface glycoprotein CD4
3	9606.ENSP00000329243	0.856	Keratin, type II cytoskeletal 7
4	9606.ENSP00000227918	0.825	Mammaglobin-A
5	9606.ENSP00000253362	0.807	BPI fold-containing family A member 2
6	9606.ENSP00000290401	0.788	Neuroplastin
7	9606.ENSP00000347409	0.767	Kell blood group glycoprotein
8	9606.ENSP00000293599	0.757	Aquaporin-5
9	9606.ENSP00000167588	0.710	Keratin, type I cytoskeletal 20
10	9606.ENSP00000221992	0.710	Carcinoembryonic antigen-related cell adhesion molecule 5
11	9606.ENSP00000325120	0.710	Progesterone receptor
12	9606.ENSP00000323036	0.688	Prostatic acid phosphatase
13	9606.ENSP00000263598	0.684	Lipocalin-1
14	9606.ENSP00000252242	0.681	Keratin, type II cytoskeletal 5
15	9606.ENSP00000269571	0.681	Receptor tyrosine-protein kinase erbB-2
16	9606.ENSP00000405330	0.681	Estrogen receptor
17	9606.ENSP00000370408	0.661	Homeobox protein CDX-2
18	9606.ENSP00000368682	0.630	Phosphate-regulating neutral endopeptidase
19	9606.ENSP00000363822	0.620	Androgen receptor
20	9606.ENSP00000368632	0.606	Trans-acting T-cell-specific transcription factor GATA-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0019865	0.999	immunoglobulin binding
GO:0004190	0.999	aspartic-type endopeptidase activity
GO:0019864	0.967	IgG binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0032501	0.994	multicellular organismal process
GO:0050896	0.993	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0042981	0.935	regulation of apoptotic process
GO:0042592	0.923	homeostatic process
GO:0042221	0.919	response to chemical
GO:0007600	0.911	sensory perception
GO:2000106	0.899	regulation of leukocyte apoptotic process
GO:0048518	0.884	positive regulation of biological process
GO:0060255	0.866	regulation of macromolecule metabolic process
GO:0071704	0.858	organic substance metabolic process
GO:0048519	0.858	negative regulation of biological process
GO:0048523	0.853	negative regulation of cellular process
GO:0010604	0.853	positive regulation of macromolecule metabolic process
GO:0010468	0.848	regulation of gene expression
GO:0044238	0.825	primary metabolic process
GO:0051606	0.824	detection of stimulus
GO:0007606	0.788	sensory perception of chemical stimulus
GO:0050909	0.744	sensory perception of taste
GO:0070228	0.702	regulation of lymphocyte apoptotic process
GO:0048871	0.686	multicellular organismal-level homeostasis
GO:0006807	0.638	nitrogen compound metabolic process
GO:0009987	0.637	cellular process
GO:0070232	0.618	regulation of T cell apoptotic process
GO:0060249	0.601	anatomical structure homeostasis
GO:0043170	0.553	macromolecule metabolic process
GO:0001894	0.532	tissue homeostasis
GO:1901564	0.530	organonitrogen compound metabolic process
GO:0001895	0.475	retina homeostasis
GO:0043066	0.392	negative regulation of apoptotic process
GO:0050906	0.384	detection of stimulus involved in sensory perception
GO:0019538	0.359	protein metabolic process
GO:0006508	0.354	proteolysis
GO:0010628	0.354	positive regulation of gene expression
GO:0050912	0.326	detection of chemical stimulus involved in sensory perception of taste

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0031982	0.999	vesicle
GO:0005634	0.997	nucleus
GO:0070062	0.993	extracellular exosome
GO:0005737	0.732	cytoplasm
GO:0070013	0.334	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.23.-	0.999	Aspartic endopeptidases.

[back to server]