StarFunc result for job id P12314

User Input

>input (374 residues)
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
TSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG
IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQ
LQEGVHRKEPQGAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12314	1.000	1.000	1.641E-67	374	1.000	1.000	P12314.pdb.gz	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
2	AFDB:P26151	0.734	0.682	1.955E-48	404	0.626	0.579	P26151.pdb.gz	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
3	AFDB:A0A0B4J2J0	0.692	0.732	1.417E-44	353	0.583	0.618	A0A0B4J2J0.pdb.gz	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
4	AFDB:Q92637	0.441	0.587	3.736E-40	280	0.733	0.979	Q92637.pdb.gz	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
5	AFDB:Q6BAA4	0.555	0.495	4.913E-28	426	0.307	0.270	Q6BAA4.pdb.gz	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1
6	AFDB:Q5DRQ8	0.576	0.512	1.036E-26	427	0.299	0.262	Q5DRQ8.pdb.gz	FCRLB_MOUSE Fc receptor-like B OS=Mus musculus OX=10090 GN=Fcrlb PE=2 SV=2
7	AFDB:Q96PJ5	0.465	0.356	5.261E-25	515	0.275	0.200	Q96PJ5.pdb.gz	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
8	AFDB:Q96RD9	0.481	0.214	2.813E-23	977	0.275	0.105	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
9	AFDB:Q68SN8	0.483	0.327	5.799E-23	596	0.249	0.156	Q68SN8.pdb.gz	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
10	AFDB:Q2V8M5	0.439	0.517	7.508E-23	310	0.198	0.239	Q2V8M5.pdb.gz	Q2V8M5_ICTPU FcRI OS=Ictalurus punctatus OX=7998 GN=LOC100304698 PE=2 SV=1
11	PDB:5oj2B	0.191	0.118	7.245E-11	692	0.136	0.074	5oj2B.pdb.gz
12	PDB:6dldD	0.187	0.238	4.421E-10	269	0.144	0.201	6dldD.pdb.gz
13	PDB:1e07A	0.209	0.147	9.597E-10	642	0.128	0.075	1e07A.pdb.gz
14	PDB:7q5zA	0.170	0.061	3.394E-8	1344	0.104	0.029	7q5zA.pdb.gz
15	PDB:6dlfA	0.187	0.276	3.763E-8	236	0.099	0.157	6dlfA.pdb.gz
16	PDB:5mj3A	0.195	0.227	1.301E-7	302	0.104	0.129	5mj3A.pdb.gz
17	PDB:7q1yA	0.165	0.060	3.850E-7	1374	0.110	0.030	7q1yA.pdb.gz
18	PDB:4lnvB	0.167	0.076	4.985E-7	1063	0.088	0.031	4lnvB.pdb.gz
19	PDB:4lnvA	0.179	0.071	1.264E-6	1276	0.139	0.041	4lnvA.pdb.gz
20	PDB:4aq1A	0.154	0.094	4.368E-6	721	0.086	0.044	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12314	0.0	772	374	1.000	1.000	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
2	P26151	6.66e-166	471	404	0.623	0.577	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
3	A0A0B4J2J0	6.14e-149	426	353	0.580	0.615	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
4	Q92637	1.68e-134	387	280	0.503	0.671	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
5	Q6BAA4	3.04e-55	189	426	0.321	0.282	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1
6	Q5DRQ8	1.65e-54	187	427	0.318	0.279	FCRLB_MOUSE Fc receptor-like B OS=Mus musculus OX=10090 GN=Fcrlb PE=2 SV=2
7	P08101	1.44e-49	171	330	0.222	0.252	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
8	O75015	2.75e-49	167	233	0.238	0.382	FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
9	P08508	7.94e-49	167	261	0.209	0.299	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
10	A3RFZ7	1.76e-48	166	254	0.235	0.346	FCG3A_MACMU Low affinity immunoglobulin gamma Fc region receptor III-A OS=Macaca mulatta OX=9544 GN=FCGR3A PE=1 SV=1
11	P08637	2.58e-48	166	254	0.230	0.339	FCG3A_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-A OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=2
12	A0A1W2PQB1	1.48e-47	165	290	0.230	0.297	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
13	Q63203	2.36e-47	164	285	0.219	0.288	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
14	P27645	1.85e-46	161	267	0.203	0.285	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
15	Q6XPU4	2.44e-46	160	249	0.195	0.293	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
16	P31994	3.10e-46	162	310	0.230	0.277	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
17	P31995	4.49e-46	162	323	0.230	0.266	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
18	A0A0B4J1G0	3.33e-45	157	249	0.225	0.337	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
19	Q7L513	4.91e-45	160	359	0.233	0.242	FCRLA_HUMAN Fc receptor-like A OS=Homo sapiens OX=9606 GN=FCRLA PE=1 SV=2
20	P12318	7.82e-45	158	317	0.209	0.246	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	1.7e+02	13.4	Adenovirus E3 region protein CR1
2	PF05790 C2-set	17	17.0	Immunoglobulin C2-set domain
3	PF07679 I-set	0.00012	33.4	Immunoglobulin I-set domain
4	PF00047 ig	8.6e-12	56.4	Immunoglobulin domain
5	PF13895 Ig_2	6.9e-26	101.7	Immunoglobulin domain
6	PF13927 Ig_3	5.1e-20	83.1	Immunoglobulin domain
7	PF16680 Ig_4	0.013	27.4	T-cell surface glycoprotein CD3 delta chain
8	PF15099 PIRT	37	15.4	Phosphoinositide-interacting protein family
9	PF07686 V-set	6.6e-09	47.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000255030	0.995	C-reactive protein
2	9606.ENSP00000364907	0.984	Tyrosine-protein kinase SYK
3	9606.ENSP00000444986	0.979	Tyrosine-protein kinase HCK
4	9606.ENSP00000428924	0.970	Tyrosine-protein kinase Lyn
5	9606.ENSP00000289902	0.968	High affinity immunoglobulin epsilon receptor subunit gamma
6	9606.ENSP00000302665	0.956	Insulin-like growth factor I
7	9606.ENSP00000363117	0.944	Tyrosine-protein kinase Fgr
8	9606.ENSP00000362680	0.939	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000346671	0.920	Tyrosine-protein kinase Fyn
10	9606.ENSP00000375616	0.914	Leukocyte immunoglobulin-like receptor subfamily B member 4
11	9606.ENSP00000227163	0.909	Transcription factor PU.1
12	9606.ENSP00000356946	0.908	Low affinity immunoglobulin gamma Fc region receptor III-A
13	9606.ENSP00000462468	0.908	Tyrosine-protein kinase Yes
14	9606.ENSP00000348461	0.907	Ras-related C3 botulinum toxin substrate 1
15	9606.ENSP00000375629	0.905	Leukocyte immunoglobulin-like receptor subfamily B member 2
16	9606.ENSP00000347714	0.904	Immunoglobulin alpha Fc receptor
17	9606.ENSP00000216181	0.902	Myosin-9
18	9606.ENSP00000262942	0.902	Actin-related protein 2/3 complex subunit 1A
19	9606.ENSP00000294742	0.902	Actin-related protein 2/3 complex subunit 5
20	9606.ENSP00000352834	0.902	Unconventional myosin-Ic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140375	1.000	immune receptor activity
GO:0004888	0.989	transmembrane signaling receptor activity
GO:0005102	0.483	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050896	0.994	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0051716	0.970	cellular response to stimulus
GO:0048522	0.969	positive regulation of cellular process
GO:0019222	0.935	regulation of metabolic process
GO:0002376	0.925	immune system process
GO:0007165	0.922	signal transduction
GO:0006909	0.914	phagocytosis
GO:0060255	0.910	regulation of macromolecule metabolic process
GO:0006954	0.906	inflammatory response
GO:0006955	0.900	immune response
GO:0002449	0.887	lymphocyte mediated immunity
GO:0071840	0.856	cellular component organization or biogenesis
GO:0016043	0.852	cellular component organization
GO:0048583	0.815	regulation of response to stimulus
GO:0051050	0.779	positive regulation of transport
GO:0002682	0.765	regulation of immune system process
GO:0002460	0.747	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0009893	0.746	positive regulation of metabolic process
GO:0010324	0.736	membrane invagination
GO:0019724	0.715	B cell mediated immunity
GO:0006911	0.685	phagocytosis, engulfment
GO:0016064	0.635	immunoglobulin mediated immune response
GO:0002526	0.628	acute inflammatory response
GO:0010604	0.607	positive regulation of macromolecule metabolic process
GO:0080090	0.598	regulation of primary metabolic process
GO:0031323	0.598	regulation of cellular metabolic process
GO:0051171	0.594	regulation of nitrogen compound metabolic process
GO:0002437	0.582	inflammatory response to antigenic stimulus
GO:0048584	0.567	positive regulation of response to stimulus
GO:0042221	0.564	response to chemical
GO:0060627	0.547	regulation of vesicle-mediated transport
GO:0002684	0.540	positive regulation of immune system process
GO:0050764	0.530	regulation of phagocytosis
GO:0065009	0.516	regulation of molecular function
GO:0019220	0.511	regulation of phosphate metabolic process
GO:0051246	0.496	regulation of protein metabolic process
GO:0042325	0.487	regulation of phosphorylation
GO:0031325	0.486	positive regulation of cellular metabolic process
GO:0007166	0.482	cell surface receptor signaling pathway
GO:0051239	0.479	regulation of multicellular organismal process
GO:0051247	0.479	positive regulation of protein metabolic process
GO:0050766	0.473	positive regulation of phagocytosis
GO:0031399	0.472	regulation of protein modification process
GO:0050790	0.467	regulation of catalytic activity
GO:0044093	0.463	positive regulation of molecular function
GO:0010033	0.463	response to organic substance
GO:0032501	0.457	multicellular organismal process
GO:0001932	0.456	regulation of protein phosphorylation
GO:0045937	0.452	positive regulation of phosphate metabolic process
GO:0051240	0.445	positive regulation of multicellular organismal process
GO:0001934	0.436	positive regulation of protein phosphorylation
GO:0043085	0.420	positive regulation of catalytic activity
GO:0009605	0.403	response to external stimulus
GO:0070887	0.393	cellular response to chemical stimulus
GO:0050776	0.381	regulation of immune response
GO:0048519	0.361	negative regulation of biological process
GO:0001906	0.355	cell killing
GO:0010468	0.353	regulation of gene expression
GO:0050778	0.339	positive regulation of immune response
GO:0023051	0.336	regulation of signaling
GO:0002444	0.330	myeloid leukocyte mediated immunity
GO:0010646	0.329	regulation of cell communication
GO:0001909	0.329	leukocyte mediated cytotoxicity
GO:0032101	0.319	regulation of response to external stimulus
GO:0080134	0.314	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.991	endomembrane system
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005737	0.945	cytoplasm
GO:0097708	0.855	intracellular vesicle
GO:0031410	0.851	cytoplasmic vesicle
GO:0031090	0.849	organelle membrane
GO:0098588	0.658	bounding membrane of organelle
GO:0012506	0.637	vesicle membrane
GO:0030659	0.618	cytoplasmic vesicle membrane
GO:0005768	0.576	endosome
GO:0030139	0.483	endocytic vesicle
GO:0009986	0.416	cell surface
GO:0098552	0.376	side of membrane
GO:0030136	0.312	clathrin-coated vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]