StarFunc result for job id P12318

User Input

>input (317 residues)
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIY
CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD
KNIYLTLPPNDHVNSNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12318	1.000	1.000	3.871E-57	317	1.000	1.000	P12318.pdb.gz	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4
2	AFDB:P31995	0.714	0.702	9.063E-46	323	0.852	0.836	P31995.pdb.gz	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
3	AFDB:P31994	0.695	0.710	1.676E-38	310	0.653	0.668	P31994.pdb.gz	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
4	AFDB:P27645	0.689	0.808	7.217E-32	267	0.416	0.494	P27645.pdb.gz	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
5	AFDB:P08101	0.631	0.607	9.453E-32	330	0.464	0.445	P08101.pdb.gz	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
6	AFDB:P08508	0.626	0.751	5.318E-31	261	0.426	0.517	P08508.pdb.gz	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
7	AFDB:Q63203	0.642	0.710	1.356E-29	285	0.432	0.481	Q63203.pdb.gz	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
8	AFDB:A0A1W2PQB1	0.548	0.594	8.497E-29	290	0.338	0.369	A0A1W2PQB1.pdb.gz	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
9	AFDB:A0A0B4J1G0	0.564	0.712	1.114E-25	249	0.309	0.394	A0A0B4J1G0.pdb.gz	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
10	AFDB:Q6XPU4	0.551	0.699	6.269E-25	249	0.303	0.386	Q6XPU4.pdb.gz	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
11	PDB:6dldD	0.194	0.221	7.537E-8	269	0.104	0.123	6dldD.pdb.gz
12	PDB:5c6wJ	0.221	0.288	2.906E-7	238	0.114	0.151	5c6wJ.pdb.gz
13	PDB:6dlfA	0.208	0.271	5.554E-7	236	0.129	0.174	6dlfA.pdb.gz
14	PDB:5oj2B	0.215	0.114	1.549E-6	692	0.126	0.058	5oj2B.pdb.gz
15	PDB:1e07A	0.213	0.114	1.635E-6	642	0.104	0.051	1e07A.pdb.gz
16	PDB:1cf8L	0.207	0.276	2.066E-5	215	0.098	0.144	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
17	PDB:1f11A	0.194	0.268	3.015E-5	216	0.082	0.120	1f11A.pdb.gz
18	PDB:1i7zA	0.197	0.263	3.182E-5	219	0.091	0.132	1i7zA.pdb.gz	Crystal structure of a cocaine-binding antibody.
19	PDB:1fj1A	0.211	0.302	3.545E-5	213	0.076	0.113	1fj1A.pdb.gz
20	PDB:3u7wL	0.193	0.270	4.168E-5	210	0.091	0.138	3u7wL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12318	0.0	663	317	1.000	1.000	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4
2	P31995	0.0	530	323	0.845	0.830	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
3	P31994	2.38e-135	388	310	0.631	0.645	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
4	P08101	5.65e-90	273	330	0.461	0.442	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
5	P27645	1.82e-82	252	267	0.416	0.494	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
6	P08508	3.23e-79	243	261	0.432	0.525	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
7	Q63203	1.50e-75	235	285	0.426	0.474	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
8	A3RFZ7	1.05e-56	186	254	0.322	0.402	FCG3A_MACMU Low affinity immunoglobulin gamma Fc region receptor III-A OS=Macaca mulatta OX=9544 GN=FCGR3A PE=1 SV=1
9	O75015	1.49e-54	179	233	0.312	0.425	FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
10	A0A0B4J1G0	1.11e-53	177	249	0.315	0.402	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
11	P08637	1.48e-53	177	254	0.309	0.386	FCG3A_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-A OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=2
12	A0A1W2PQB1	5.65e-53	177	290	0.341	0.372	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
13	Q6XPU4	2.66e-51	171	249	0.271	0.345	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
14	Q92637	8.88e-48	163	280	0.281	0.318	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
15	P12314	2.30e-47	165	374	0.268	0.227	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
16	P26151	3.87e-41	149	404	0.243	0.191	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
17	A0A0B4J2J0	1.11e-40	147	353	0.246	0.221	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
18	V9GY55	1.11e-39	136	86	0.205	0.756	V9GY55_HUMAN Fc gamma receptor IIa (Fragment) OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1
19	P12319	2.01e-39	141	257	0.243	0.300	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
20	Q6BAA4	2.11e-33	129	426	0.218	0.162	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	2.1e+02	13.1	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF17957 Big_7	13	18.0	Bacterial Ig domain
3	PF07654 C1-set	73	15.2	Immunoglobulin C1-set domain
4	PF08205 C2-set_2	19	16.7	CD80-like C2-set immunoglobulin domain
5	PF12877 DUF3827	3.2e+02	11.0	Domain of unknown function (DUF3827)
6	PF15820 ECSCR	1.3e+02	13.8	Endothelial cell-specific chemotaxis regulator
7	PF07679 I-set	0.00029	32.1	Immunoglobulin I-set domain
8	PF00047 ig	9.1e-07	40.3	Immunoglobulin domain
9	PF13895 Ig_2	9.2e-22	88.5	Immunoglobulin domain
10	PF13927 Ig_3	6.4e-14	63.6	Immunoglobulin domain
11	PF16680 Ig_4	0.00013	33.8	T-cell surface glycoprotein CD3 delta chain
12	PF16681 Ig_5	0.0026	29.5	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
13	PF12273 RCR	19	17.3	Chitin synthesis regulation, resistance to Congo red
14	PF13965 SID-1_RNA_chan	5.3e+02	10.5	dsRNA-gated channel SID-1
15	PF07686 V-set	0.0052	28.3	Immunoglobulin V-set domain
16	PF08204 V-set_CD47	3.8e+02	12.5	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271450

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364907	0.998	Tyrosine-protein kinase SYK
2	9606.ENSP00000441691	0.995	Integrin alpha-M
3	9606.ENSP00000255030	0.993	C-reactive protein
4	9606.ENSP00000428924	0.972	Tyrosine-protein kinase Lyn
5	9606.ENSP00000444986	0.969	Tyrosine-protein kinase HCK
6	9606.ENSP00000346671	0.957	Tyrosine-protein kinase Fyn
7	9606.ENSP00000380948	0.957	Integrin beta-2
8	9606.ENSP00000362680	0.943	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000363117	0.942	Tyrosine-protein kinase Fgr
10	9606.ENSP00000378845	0.936	Linker for activation of T cells
11	9606.ENSP00000289902	0.918	High affinity immunoglobulin epsilon receptor subunit gamma
12	9606.ENSP00000375629	0.917	Leukocyte immunoglobulin-like receptor subfamily B member 2
13	9606.ENSP00000348461	0.909	Ras-related C3 botulinum toxin substrate 1
14	9606.ENSP00000462468	0.908	Tyrosine-protein kinase Yes
15	9606.ENSP00000255040	0.907	Serum amyloid P-component
16	9606.ENSP00000352834	0.904	Unconventional myosin-Ic
17	9606.ENSP00000294742	0.902	Actin-related protein 2/3 complex subunit 5
18	9606.ENSP00000389631	0.902	Actin-related protein 2/3 complex subunit 1B
19	9606.ENSP00000471457	0.902	Unconventional myosin-IXb
20	9606.ENSP00000262942	0.901	Actin-related protein 2/3 complex subunit 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.946	signaling receptor activity
GO:0004888	0.750	transmembrane signaling receptor activity
GO:0044877	0.301	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0050776	0.988	regulation of immune response
GO:0002697	0.986	regulation of immune effector process
GO:0002683	0.985	negative regulation of immune system process
GO:0009987	0.984	cellular process
GO:0048585	0.981	negative regulation of response to stimulus
GO:0048518	0.980	positive regulation of biological process
GO:0002703	0.979	regulation of leukocyte mediated immunity
GO:0002822	0.977	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0050777	0.972	negative regulation of immune response
GO:0002706	0.970	regulation of lymphocyte mediated immunity
GO:0031347	0.969	regulation of defense response
GO:0002252	0.965	immune effector process
GO:0002889	0.956	regulation of immunoglobulin mediated immune response
GO:0016192	0.954	vesicle-mediated transport
GO:0051239	0.951	regulation of multicellular organismal process
GO:0002698	0.951	negative regulation of immune effector process
GO:0050727	0.948	regulation of inflammatory response
GO:0019222	0.946	regulation of metabolic process
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:0050778	0.941	positive regulation of immune response
GO:0006955	0.933	immune response
GO:0032501	0.930	multicellular organismal process
GO:0006950	0.927	response to stress
GO:0048856	0.912	anatomical structure development
GO:0051716	0.910	cellular response to stimulus
GO:0001817	0.901	regulation of cytokine production
GO:0050865	0.900	regulation of cell activation
GO:0060627	0.900	regulation of vesicle-mediated transport
GO:0002694	0.892	regulation of leukocyte activation
GO:0002861	0.875	regulation of inflammatory response to antigenic stimulus
GO:0051249	0.871	regulation of lymphocyte activation
GO:0001775	0.862	cell activation
GO:0023051	0.854	regulation of signaling
GO:0001818	0.847	negative regulation of cytokine production
GO:0045321	0.833	leukocyte activation
GO:0010646	0.802	regulation of cell communication
GO:0002831	0.791	regulation of response to biotic stimulus
GO:0009966	0.777	regulation of signal transduction
GO:0009605	0.769	response to external stimulus
GO:0046649	0.763	lymphocyte activation
GO:0048522	0.762	positive regulation of cellular process
GO:0048523	0.745	negative regulation of cellular process
GO:0010604	0.740	positive regulation of macromolecule metabolic process
GO:0007166	0.731	cell surface receptor signaling pathway
GO:0051050	0.721	positive regulation of transport
GO:0031348	0.715	negative regulation of defense response
GO:0002460	0.711	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0050766	0.711	positive regulation of phagocytosis
GO:0006898	0.706	receptor-mediated endocytosis
GO:0002699	0.702	positive regulation of immune effector process
GO:0002695	0.689	negative regulation of leukocyte activation
GO:0006909	0.670	phagocytosis
GO:0002700	0.633	regulation of production of molecular mediator of immune response
GO:0051240	0.627	positive regulation of multicellular organismal process
GO:0006952	0.624	defense response
GO:0002823	0.618	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002705	0.609	positive regulation of leukocyte mediated immunity
GO:0002707	0.605	negative regulation of lymphocyte mediated immunity
GO:0002708	0.587	positive regulation of lymphocyte mediated immunity
GO:0002920	0.583	regulation of humoral immune response
GO:0071840	0.578	cellular component organization or biogenesis
GO:0002824	0.578	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002886	0.549	regulation of myeloid leukocyte mediated immunity
GO:0002891	0.523	positive regulation of immunoglobulin mediated immune response
GO:0048869	0.510	cellular developmental process
GO:0002673	0.508	regulation of acute inflammatory response
GO:0031341	0.500	regulation of cell killing
GO:0042221	0.474	response to chemical
GO:0001910	0.450	regulation of leukocyte mediated cytotoxicity
GO:0031323	0.444	regulation of cellular metabolic process
GO:0080090	0.443	regulation of primary metabolic process
GO:0002764	0.443	immune response-regulating signaling pathway
GO:0051171	0.441	regulation of nitrogen compound metabolic process
GO:0042113	0.399	B cell activation
GO:0051051	0.397	negative regulation of transport
GO:0010033	0.322	response to organic substance
GO:0042127	0.320	regulation of cell population proliferation
GO:0016043	0.319	cellular component organization
GO:0070887	0.316	cellular response to chemical stimulus
GO:0044419	0.315	biological process involved in interspecies interaction between organisms
GO:0009607	0.309	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0005622	0.987	intracellular anatomical structure
GO:0043229	0.967	intracellular organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005737	0.954	cytoplasm
GO:0031982	0.856	vesicle
GO:0097708	0.826	intracellular vesicle
GO:0031410	0.822	cytoplasmic vesicle
GO:0031090	0.609	organelle membrane
GO:0030659	0.472	cytoplasmic vesicle membrane
GO:0099503	0.439	secretory vesicle
GO:0009986	0.375	cell surface
GO:0030141	0.375	secretory granule
GO:0098588	0.362	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]