StarFunc result for job id P12319

User Input

>input (257 residues)
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS
STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAE
VVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKV
WQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTR
KGFRLLNPHPKPNPKNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12319	1.000	1.000	1.703E-47	257	1.000	1.000	P12319.pdb.gz	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
2	AFDB:P20489	0.791	0.811	1.159E-28	250	0.475	0.488	P20489.pdb.gz	FCERA_MOUSE High affinity immunoglobulin epsilon receptor subunit alpha OS=Mus musculus OX=10090 GN=Fcer1a PE=2 SV=2
3	AFDB:P12371	0.840	0.879	3.915E-28	245	0.451	0.473	P12371.pdb.gz	FCERA_RAT High affinity immunoglobulin epsilon receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Fcer1a PE=1 SV=1
4	AFDB:A0A1W2PQB1	0.615	0.550	3.652E-26	290	0.366	0.324	A0A1W2PQB1.pdb.gz	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
5	AFDB:P27645	0.764	0.738	1.538E-25	267	0.339	0.326	P27645.pdb.gz	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
6	AFDB:P08508	0.767	0.756	4.915E-25	261	0.339	0.333	P08508.pdb.gz	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
7	AFDB:P31994	0.656	0.550	6.132E-25	310	0.342	0.284	P31994.pdb.gz	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
8	AFDB:P12318	0.713	0.585	1.066E-24	317	0.327	0.265	P12318.pdb.gz	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4
9	AFDB:P31995	0.668	0.542	1.259E-24	323	0.339	0.269	P31995.pdb.gz	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
10	AFDB:P08101	0.669	0.528	1.660E-24	330	0.342	0.267	P08101.pdb.gz	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
11	PDB:6dldD	0.233	0.223	2.655E-9	269	0.113	0.108	6dldD.pdb.gz
12	PDB:5c6wJ	0.261	0.280	5.562E-8	238	0.152	0.164	5c6wJ.pdb.gz
13	PDB:5oj2B	0.233	0.098	2.343E-7	692	0.125	0.046	5oj2B.pdb.gz
14	PDB:6dlfA	0.249	0.269	2.766E-7	236	0.144	0.157	6dlfA.pdb.gz
15	PDB:1e07A	0.258	0.121	2.528E-6	642	0.152	0.061	1e07A.pdb.gz
16	PDB:6dcvA	0.253	0.291	6.473E-6	220	0.125	0.145	6dcvA.pdb.gz
17	PDB:3o3uN	0.225	0.116	1.189E-5	580	0.125	0.055	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
18	PDB:1q0xL	0.213	0.254	1.568E-5	212	0.117	0.142	1q0xL.pdb.gz
19	PDB:4xnyL	0.245	0.292	2.727E-5	211	0.121	0.147	4xnyL.pdb.gz
20	PDB:3u7wL	0.236	0.272	3.046E-5	210	0.093	0.114	3u7wL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12319	0.0	533	257	1.000	1.000	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
2	P20489	7.49e-82	247	250	0.475	0.488	FCERA_MOUSE High affinity immunoglobulin epsilon receptor subunit alpha OS=Mus musculus OX=10090 GN=Fcer1a PE=2 SV=2
3	P12371	3.26e-74	228	245	0.440	0.461	FCERA_RAT High affinity immunoglobulin epsilon receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Fcer1a PE=1 SV=1
4	Q6XPU4	2.74e-49	164	249	0.335	0.345	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
5	A3RFZ7	8.18e-47	158	254	0.335	0.339	FCG3A_MACMU Low affinity immunoglobulin gamma Fc region receptor III-A OS=Macaca mulatta OX=9544 GN=FCGR3A PE=1 SV=1
6	P08637	1.00e-46	158	254	0.339	0.343	FCG3A_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-A OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=2
7	A0A1W2PQB1	1.19e-46	159	290	0.339	0.300	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
8	A0A0B4J1G0	1.96e-46	157	249	0.339	0.349	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
9	Q92637	3.83e-46	157	280	0.327	0.300	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
10	O75015	3.23e-45	153	233	0.335	0.369	FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
11	P08508	1.15e-44	153	261	0.323	0.318	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
12	P27645	3.25e-44	152	267	0.315	0.303	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
13	P12314	6.63e-42	149	374	0.284	0.195	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
14	P26151	1.17e-40	146	404	0.280	0.178	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
15	P08101	3.76e-40	143	330	0.327	0.255	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
16	Q63203	5.74e-40	141	285	0.280	0.253	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
17	A0A0B4J2J0	9.35e-40	142	353	0.307	0.224	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
18	P31994	1.39e-39	141	310	0.296	0.245	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
19	P31995	1.53e-39	141	323	0.296	0.235	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
20	Q6BAA4	1.48e-36	135	426	0.280	0.169	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	24	16.1	Adenovirus E3 region protein CR1
2	PF07654 C1-set	2.2e+02	13.6	Immunoglobulin C1-set domain
3	PF05790 C2-set	8.9	17.9	Immunoglobulin C2-set domain
4	PF07679 I-set	0.00042	31.7	Immunoglobulin I-set domain
5	PF00047 ig	9.3e-07	40.3	Immunoglobulin domain
6	PF13895 Ig_2	2.3e-19	80.8	Immunoglobulin domain
7	PF13927 Ig_3	2e-15	68.4	Immunoglobulin domain
8	PF16680 Ig_4	7.4e-06	37.8	T-cell surface glycoprotein CD3 delta chain
9	PF16681 Ig_5	6.2e-05	34.7	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
10	PF16706 Izumo-Ig	0.17	23.1	Izumo-like Immunoglobulin domain
11	PF11465 Receptor_2B4	80	14.9	Natural killer cell receptor 2B4
12	PF07811 TadE	5.3e+02	12.2	TadE-like protein
13	PF07686 V-set	2.3e-06	39.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289902	0.993	High affinity immunoglobulin epsilon receptor subunit gamma
2	9606.ENSP00000278888	0.966	High affinity immunoglobulin epsilon receptor subunit beta
3	9606.ENSP00000428924	0.964	Tyrosine-protein kinase Lyn
4	9606.ENSP00000364907	0.958	Tyrosine-protein kinase SYK
5	9606.ENSP00000046794	0.952	Lymphocyte cytosolic protein 2
6	9606.ENSP00000346671	0.940	Tyrosine-protein kinase Fyn
7	9606.ENSP00000313681	0.933	Sphingosine kinase 1
8	9606.ENSP00000483570	0.933	Tyrosine-protein kinase BTK
9	9606.ENSP00000244007	0.926	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
10	9606.ENSP00000351497	0.924	Low affinity immunoglobulin gamma Fc region receptor II-b
11	9606.ENSP00000349477	0.923	Killer cell lectin-like receptor subfamily G member 1
12	9606.ENSP00000340944	0.918	Tyrosine-protein phosphatase non-receptor type 11
13	9606.ENSP00000320176	0.915	Hematopoietic lineage cell-specific protein
14	9606.ENSP00000360266	0.914	Transcription factor AP-1
15	9606.ENSP00000405338	0.913	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
16	9606.ENSP00000420494	0.909	Linker for activation of T-cells family member 2
17	9606.ENSP00000472929	0.908	Proto-oncogene vav
18	9606.ENSP00000379330	0.907	Nuclear factor of activated T-cells, cytoplasmic 2
19	9606.ENSP00000306245	0.906	Proto-oncogene c-Fos
20	9606.ENSP00000398655	0.906	Tyrosine-protein kinase ITK/TSK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0019865	0.437	immunoglobulin binding
GO:0038023	0.397	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050896	0.993	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0048583	0.953	regulation of response to stimulus
GO:0002376	0.947	immune system process
GO:0023052	0.861	signaling
GO:0007154	0.860	cell communication
GO:0051716	0.859	cellular response to stimulus
GO:0048518	0.850	positive regulation of biological process
GO:0006955	0.813	immune response
GO:0019222	0.807	regulation of metabolic process
GO:0007165	0.757	signal transduction
GO:0002252	0.755	immune effector process
GO:0060255	0.743	regulation of macromolecule metabolic process
GO:0051239	0.741	regulation of multicellular organismal process
GO:0048522	0.725	positive regulation of cellular process
GO:0002682	0.721	regulation of immune system process
GO:0032501	0.714	multicellular organismal process
GO:0009893	0.693	positive regulation of metabolic process
GO:0010604	0.683	positive regulation of macromolecule metabolic process
GO:0048584	0.617	positive regulation of response to stimulus
GO:0050776	0.609	regulation of immune response
GO:0031323	0.551	regulation of cellular metabolic process
GO:0002684	0.528	positive regulation of immune system process
GO:0010468	0.475	regulation of gene expression
GO:0007166	0.475	cell surface receptor signaling pathway
GO:0080090	0.463	regulation of primary metabolic process
GO:0051171	0.459	regulation of nitrogen compound metabolic process
GO:0006950	0.457	response to stress
GO:0048519	0.453	negative regulation of biological process
GO:0008152	0.427	metabolic process
GO:0042221	0.405	response to chemical
GO:0071704	0.399	organic substance metabolic process
GO:0050865	0.347	regulation of cell activation
GO:0050778	0.342	positive regulation of immune response
GO:0051240	0.326	positive regulation of multicellular organismal process
GO:0031325	0.324	positive regulation of cellular metabolic process
GO:0065009	0.318	regulation of molecular function
GO:0009966	0.317	regulation of signal transduction
GO:0051179	0.307	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.964	cell surface
GO:0043231	0.940	intracellular membrane-bounded organelle
GO:0005737	0.929	cytoplasm
GO:0012505	0.857	endomembrane system
GO:0097708	0.707	intracellular vesicle
GO:0031410	0.690	cytoplasmic vesicle
GO:0005576	0.601	extracellular region
GO:0032991	0.584	protein-containing complex
GO:0031090	0.437	organelle membrane
GO:0098588	0.422	bounding membrane of organelle
GO:0005615	0.339	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]