StarFunc result for job id P12429

User Input

>input (323 residues)
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEY
QAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR
TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQ
ILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL
LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY
SAIKSDTSGDYEITLLKICGGDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12429	1.000	1.000	7.493E-50	323	1.000	1.000	P12429.pdb.gz	ANXA3_HUMAN Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3
2	PDB:1axnA	0.994	0.994	4.199E-46	323	0.997	0.997	1axnA.pdb.gz	The high-resolution crystal structure of human annexin III shows subtle differences with annexin V.
3	AFDB:P14669	0.995	0.992	1.582E-44	324	0.851	0.849	P14669.pdb.gz	ANXA3_RAT Annexin A3 OS=Rattus norvegicus OX=10116 GN=Anxa3 PE=1 SV=4
4	AFDB:P50995	0.960	0.618	4.279E-34	505	0.514	0.329	P50995.pdb.gz	ANX11_HUMAN Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
5	AFDB:P09525	0.945	0.956	1.393E-33	319	0.520	0.527	P09525.pdb.gz	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
6	PDB:2zocA	0.956	0.968	4.159E-33	319	0.520	0.527	2zocA.pdb.gz	The comparison of the loop structure of membrane binding sites between human and bovine annexin IV
7	AFDB:P81287	0.943	0.948	1.546E-32	321	0.492	0.495	P81287.pdb.gz	ANXA5_BOVIN Annexin A5 OS=Bos taurus OX=9913 GN=ANXA5 PE=1 SV=3
8	AFDB:B5XAE0	0.932	0.950	1.940E-32	317	0.461	0.470	B5XAE0.pdb.gz	B5XAE0_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA5 PE=2 SV=1
9	AFDB:P20073	0.944	0.630	1.940E-32	488	0.449	0.297	P20073.pdb.gz	ANXA7_HUMAN Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 PE=1 SV=3
10	AFDB:P17153	0.932	0.938	2.666E-32	321	0.505	0.508	P17153.pdb.gz	ANXA5_CHICK Annexin A5 OS=Gallus gallus OX=9031 GN=ANXA5 PE=1 SV=2
11	AFDB:P20072	0.947	0.665	4.812E-32	463	0.461	0.322	P20072.pdb.gz	ANXA7_BOVIN Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=2
12	AFDB:A8KBY8	0.961	0.469	5.770E-32	667	0.517	0.250	A8KBY8.pdb.gz	A8KBY8_DANRE Annexin OS=Danio rerio OX=7955 GN=anx6 PE=1 SV=1
13	PDB:7p70A	0.959	0.764	5.608E-31	407	0.467	0.371	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:2h0kA	0.910	0.924	1.160E-30	318	0.467	0.475	2h0kA.pdb.gz	Annexin-A5 assembled into two-dimensional arrays promotes cell membrane repair.
15	PDB:5n7dA	0.959	0.736	1.329E-30	423	0.467	0.357	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
16	PDB:7p73A	0.959	0.741	3.009E-30	420	0.467	0.360	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:1avcA	0.946	0.481	3.448E-30	642	0.511	0.257	1avcA.pdb.gz	Crystal structure of bovine annexin VI in a calcium-bound state.
18	PDB:7qqnC	0.934	0.733	8.948E-30	414	0.458	0.357	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:1ainA	0.946	0.973	2.430E-29	314	0.483	0.497	1ainA.pdb.gz
20	PDB:7qqmA	0.917	0.722	2.914E-29	413	0.464	0.363	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35639	0.0	600	323	0.898	0.898	ANXA3_MOUSE Annexin A3 OS=Mus musculus OX=10090 GN=Anxa3 PE=1 SV=4
2	P12429	0.0	661	323	1.000	1.000	ANXA3_HUMAN Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3
3	P14669	0.0	566	324	0.851	0.849	ANXA3_RAT Annexin A3 OS=Rattus norvegicus OX=10116 GN=Anxa3 PE=1 SV=4
4	P13214	3.52e-117	342	319	0.520	0.527	ANXA4_BOVIN Annexin A4 OS=Bos taurus OX=9913 GN=ANXA4 PE=1 SV=2
5	P09525	3.75e-117	342	319	0.520	0.527	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
6	P97429	4.57e-115	337	319	0.514	0.520	ANXA4_MOUSE Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 SV=4
7	P33477	2.97e-114	341	503	0.520	0.334	ANX11_RABIT Annexin A11 OS=Oryctolagus cuniculus OX=9986 GN=ANXA11 PE=1 SV=1
8	P50995	1.91e-113	339	505	0.514	0.329	ANX11_HUMAN Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
9	Q5T0G8	1.91e-113	339	505	0.514	0.329	Q5T0G8_HUMAN Annexin OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
10	P17153	2.27e-111	328	321	0.498	0.502	ANXA5_CHICK Annexin A5 OS=Gallus gallus OX=9031 GN=ANXA5 PE=1 SV=2
11	P97384	7.15e-111	333	503	0.508	0.326	ANX11_MOUSE Annexin A11 OS=Mus musculus OX=10090 GN=Anxa11 PE=1 SV=2
12	A8KBY8	1.04e-109	335	667	0.517	0.250	A8KBY8_DANRE Annexin OS=Danio rerio OX=7955 GN=anx6 PE=1 SV=1
13	P79134	1.84e-109	334	673	0.514	0.247	ANXA6_BOVIN Annexin A6 OS=Bos taurus OX=9913 GN=ANXA6 PE=1 SV=2
14	P81287	6.23e-109	322	321	0.486	0.489	ANXA5_BOVIN Annexin A5 OS=Bos taurus OX=9913 GN=ANXA5 PE=1 SV=3
15	P08758	1.13e-108	321	320	0.489	0.494	ANXA5_HUMAN Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2
16	P08133	1.63e-106	327	673	0.508	0.244	ANXA6_HUMAN Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6 PE=1 SV=3
17	P48036	5.84e-106	314	319	0.474	0.480	ANXA5_MOUSE Annexin A5 OS=Mus musculus OX=10090 GN=Anxa5 PE=1 SV=1
18	P14668	6.73e-106	313	319	0.474	0.480	ANXA5_RAT Annexin A5 OS=Rattus norvegicus OX=10116 GN=Anxa5 PE=1 SV=3
19	P14824	1.04e-105	325	673	0.514	0.247	ANXA6_MOUSE Annexin A6 OS=Mus musculus OX=10090 GN=Anxa6 PE=1 SV=3
20	M3VH45	2.08e-105	324	673	0.498	0.239	M3VH45_PIG Annexin OS=Sus scrofa OX=9823 GN=ANXA6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00191 Annexin	6.4e-102	345.0	Annexin
2	PF16798 DUF5069	2e+02	13.6	Domain of unknown function (DUF5069)
3	PF13446 RPT	2.2e+02	13.2	A repeated domain in UCH-protein
4	PF16909 VPS13_C	4.9e+02	11.9	Vacuolar-sorting-associated 13 protein C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264908

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000413606	0.845	Syntaxin-binding protein 2
2	9606.ENSP00000398610	0.754	Annexin A11
3	9606.ENSP00000311032	0.699	Caspase-3
4	9606.ENSP00000447730	0.689	CD63 antigen
5	9606.ENSP00000371958	0.685	CD9 antigen
6	9606.ENSP00000251968	0.683	Tumor susceptibility gene 101 protein
7	9606.ENSP00000263645	0.681	CD81 antigen
8	9606.ENSP00000249647	0.666	Synaptosomal-associated protein 23
9	9606.ENSP00000317714	0.657	Syntaxin-4
10	9606.ENSP00000227155	0.607	CD82 antigen
11	9606.ENSP00000312286	0.604	Phospholipase A2
12	9606.ENSP00000386881	0.578	Dysferlin
13	9606.ENSP00000330237	0.556	Caspase-9
14	9606.ENSP00000357726	0.529	Protein S100-A12
15	9606.ENSP00000335153	0.526	Heat shock protein HSP 90-alpha
16	9606.ENSP00000302961	0.522	Heat shock protein family A member 4
17	9606.ENSP00000312675	0.519	Tripartite motif-containing protein 72
18	9606.ENSP00000307786	0.516	Cytochrome c
19	9606.ENSP00000417050	0.505	Tetraspanin
20	9606.ENSP00000271638	0.503	Protein S100-A11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005544	0.998	calcium-dependent phospholipid binding
GO:0048306	0.963	calcium-dependent protein binding
GO:0043167	0.809	ion binding
GO:0042802	0.500	identical protein binding
GO:0046872	0.500	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050896	0.984	response to stimulus
GO:0048518	0.974	positive regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0048522	0.948	positive regulation of cellular process
GO:0019222	0.944	regulation of metabolic process
GO:0060255	0.921	regulation of macromolecule metabolic process
GO:0080090	0.919	regulation of primary metabolic process
GO:0032501	0.913	multicellular organismal process
GO:0002252	0.901	immune effector process
GO:0051171	0.899	regulation of nitrogen compound metabolic process
GO:0051179	0.894	localization
GO:2000147	0.851	positive regulation of cell motility
GO:0051234	0.840	establishment of localization
GO:0006810	0.818	transport
GO:0002443	0.803	leukocyte mediated immunity
GO:0006955	0.792	immune response
GO:0006887	0.780	exocytosis
GO:0036230	0.779	granulocyte activation
GO:0030335	0.776	positive regulation of cell migration
GO:0002444	0.758	myeloid leukocyte mediated immunity
GO:0006950	0.754	response to stress
GO:0045055	0.752	regulated exocytosis
GO:0031323	0.750	regulation of cellular metabolic process
GO:0002366	0.741	leukocyte activation involved in immune response
GO:0010468	0.739	regulation of gene expression
GO:0010556	0.737	regulation of macromolecule biosynthetic process
GO:0065009	0.716	regulation of molecular function
GO:0010594	0.716	regulation of endothelial cell migration
GO:0043299	0.707	leukocyte degranulation
GO:0019219	0.680	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.676	positive regulation of metabolic process
GO:0010604	0.608	positive regulation of macromolecule metabolic process
GO:0032502	0.585	developmental process
GO:0050793	0.561	regulation of developmental process
GO:0006952	0.534	defense response
GO:2000026	0.531	regulation of multicellular organismal development
GO:0051240	0.520	positive regulation of multicellular organismal process
GO:0031326	0.491	regulation of cellular biosynthetic process
GO:0002275	0.468	myeloid cell activation involved in immune response
GO:0048856	0.464	anatomical structure development
GO:0051716	0.461	cellular response to stimulus
GO:0008152	0.456	metabolic process
GO:0044419	0.452	biological process involved in interspecies interaction between organisms
GO:0042221	0.436	response to chemical
GO:0071840	0.423	cellular component organization or biogenesis
GO:0071704	0.417	organic substance metabolic process
GO:0007154	0.401	cell communication
GO:0044093	0.386	positive regulation of molecular function
GO:0016043	0.386	cellular component organization
GO:0048519	0.378	negative regulation of biological process
GO:0051173	0.366	positive regulation of nitrogen compound metabolic process
GO:0048523	0.355	negative regulation of cellular process
GO:0051252	0.354	regulation of RNA metabolic process
GO:2001141	0.322	regulation of RNA biosynthetic process
GO:0023052	0.318	signaling
GO:0048583	0.317	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.998	vesicle
GO:0012505	0.997	endomembrane system
GO:0005576	0.977	extracellular region
GO:0005886	0.966	plasma membrane
GO:0005615	0.937	extracellular space
GO:0005829	0.932	cytosol
GO:0031090	0.891	organelle membrane
GO:0030141	0.887	secretory granule
GO:0043230	0.879	extracellular organelle
GO:0070062	0.860	extracellular exosome
GO:0012506	0.807	vesicle membrane
GO:0030659	0.796	cytoplasmic vesicle membrane
GO:0030139	0.784	endocytic vesicle
GO:0098588	0.766	bounding membrane of organelle
GO:0030312	0.699	external encapsulating structure
GO:0043233	0.608	organelle lumen
GO:0005634	0.584	nucleus
GO:0070013	0.521	intracellular organelle lumen
GO:0032991	0.436	protein-containing complex
GO:0031012	0.408	extracellular matrix
GO:0062023	0.358	collagen-containing extracellular matrix
GO:0005773	0.327	vacuole
GO:0120025	0.325	plasma membrane bounded cell projection
GO:0042581	0.310	specific granule
GO:0030666	0.303	endocytic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]