StarFunc result for job id P12524

User Input

>input (364 residues)
MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGP
PEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRG
NPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQS
LGIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEEASERGPQEEVLER
DAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSR
FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAY
LTGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10166	0.484	0.480	1.468E-46	368	0.901	0.891	P10166.pdb.gz	MYCL_MOUSE Protein L-Myc OS=Mus musculus OX=10090 GN=Mycl PE=2 SV=1
2	AFDB:P12525	0.363	0.368	5.683E-37	358	0.714	0.726	P12525.pdb.gz	MYCP1_HUMAN Putative myc-like protein MYCLP1 OS=Homo sapiens OX=9606 GN=MYCLP1 PE=5 SV=2
3	AFDB:P04198	0.288	0.231	1.598E-14	464	0.420	0.330	P04198.pdb.gz	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
4	AFDB:A0A087WUS5	0.255	0.206	1.952E-14	454	0.385	0.308	A0A087WUS5.pdb.gz
5	AFDB:Q7ZVS9	0.280	0.260	2.725E-14	396	0.374	0.343	Q7ZVS9.pdb.gz	MYCB_DANRE Transcriptional regulator Myc-B OS=Danio rerio OX=7955 GN=mycb PE=2 SV=1
6	AFDB:P52160	0.293	0.263	3.547E-12	408	0.382	0.341	P52160.pdb.gz	MYCA_DANRE Transcriptional regulator Myc-A OS=Danio rerio OX=7955 GN=myca PE=2 SV=3
7	AFDB:Q8VIP2	0.255	0.117	4.891E-4	865	0.198	0.083	Q8VIP2.pdb.gz	MLXPL_RAT Carbohydrate-responsive element-binding protein OS=Rattus norvegicus OX=10116 GN=Mlxipl PE=1 SV=1
8	AFDB:A0A0C4DG26	0.239	0.123	7.802E-4	721	0.217	0.110	A0A0C4DG26.pdb.gz	A0A0C4DG26_HUMAN HCG18989, isoform CRA_h OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
9	AFDB:A6XLD8	0.231	0.083	1.330E-3	1105	0.201	0.066	A6XLD8.pdb.gz	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
10	AFDB:Q5N802	0.145	0.111	1.520E-3	481	0.170	0.129	Q5N802.pdb.gz	Q5N802_ORYSJ BHLH transcription factor OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0915600 PE=1 SV=1
11	PDB:2bskD	0.098	0.298	6.417	90	0.047	0.189	2bskD.pdb.gz
12	PDB:3ojaA	0.180	0.143	6.860	482	0.038	0.029	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
13	PDB:6lo8E	0.099	0.383	6.860	80	0.025	0.113	6lo8E.pdb.gz
14	PDB:6hivDH	0.069	0.047	7.333	564	0.041	0.027	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:3jd5d	0.088	0.148	8.957	176	0.069	0.142	3jd5d.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
16	PDB:6bk8K	0.079	0.227	9.575	82	0.038	0.171	6bk8K.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:7abzQ	0.122	0.333	9.575	117	0.022	0.068	7abzQ.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
18	PDB:7mqaNA	0.059	0.069	9.575	295	0.033	0.041	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10166	0.0	615	368	0.898	0.889	MYCL_MOUSE Protein L-Myc OS=Mus musculus OX=10090 GN=Mycl PE=2 SV=1
2	P12524	0.0	748	364	1.000	1.000	MYCL_HUMAN Protein L-Myc OS=Homo sapiens OX=9606 GN=MYCL PE=1 SV=2
3	P12525	0.0	508	358	0.714	0.726	MYCP1_HUMAN Putative myc-like protein MYCLP1 OS=Homo sapiens OX=9606 GN=MYCLP1 PE=5 SV=2
4	E9PQS5	2.22e-70	217	100	0.275	1.000	E9PQS5_HUMAN MYCL proto-oncogene, bHLH transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=MYCL PE=4 SV=1
5	Q7ZVS9	1.54e-52	181	396	0.396	0.364	MYCB_DANRE Transcriptional regulator Myc-B OS=Danio rerio OX=7955 GN=mycb PE=2 SV=1
6	P52160	8.86e-44	158	408	0.376	0.336	MYCA_DANRE Transcriptional regulator Myc-A OS=Danio rerio OX=7955 GN=myca PE=2 SV=3
7	A0A060WAZ1	5.53e-42	153	406	0.387	0.347	A0A060WAZ1_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065805001 PE=4 SV=1
8	Q2L4Q4	6.13e-42	153	407	0.387	0.346	Q2L4Q4_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=myc PE=2 SV=1
9	P06646	7.24e-41	150	414	0.396	0.348	MYC_ONCMY Transcriptional regulator Myc (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=myc PE=3 SV=1
10	P01106	1.08e-35	137	439	0.412	0.342	MYC_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=2
11	P03966	4.17e-31	124	462	0.247	0.195	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2
12	A0A1W2PPD9	6.32e-30	117	253	0.245	0.352	A0A1W2PPD9_HUMAN MYCN proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=1
13	P04198	5.96e-29	119	464	0.245	0.192	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
14	A0A494C1T8	3.36e-24	103	339	0.305	0.327	A0A494C1T8_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1
15	P09416	5.91e-23	101	439	0.214	0.178	MYC_RAT Myc proto-oncogene protein OS=Rattus norvegicus OX=10116 GN=Myc PE=1 SV=2
16	Q28350	4.24e-22	99.0	439	0.203	0.169	MYC_CANLF Myc proto-oncogene protein OS=Canis lupus familiaris OX=9615 GN=MYC PE=2 SV=2
17	P01108	1.00e-21	97.8	439	0.209	0.173	MYC_MOUSE Myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Myc PE=1 SV=2
18	B2KUA9	2.31e-15	78.6	360	0.275	0.278	B2KUA9_DANRE Transcriptional regulator OS=Danio rerio OX=7955 GN=id:ibd5144 PE=2 SV=1
19	P01109	2.49e-11	67.0	416	0.110	0.096	MYC_CHICK Myc proto-oncogene protein OS=Gallus gallus OX=9031 GN=MYC PE=1 SV=2
20	A0A0B4J1R1	2.24e-10	62.8	257	0.154	0.218	A0A0B4J1R1_HUMAN MYC proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11690 DUF3287	3.2e+02	12.4	Protein of unknown function (DUF3287)
2	PF00010 HLH	1.2e-09	49.3	Helix-loop-helix DNA-binding domain
3	PF01056 Myc_N	5.7e-30	116.9	Myc amino-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380494

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374213	0.846	E1A-binding protein p400
2	9606.ENSP00000351490	0.804	Protein max
3	9606.ENSP00000363314	0.781	Protein lin-28 homolog A
4	9606.ENSP00000259915	0.764	POU domain, class 5, transcription factor 1
5	9606.ENSP00000361857	0.764	Zinc finger protein Rlf
6	9606.ENSP00000363804	0.732	Krueppel-like factor 4
7	9606.ENSP00000352925	0.727	Transformation/transcription domain-associated protein
8	9606.ENSP00000361918	0.721	Peptidyl-prolyl cis-trans isomerase E
9	9606.ENSP00000323588	0.717	Transcription factor SOX-2
10	9606.ENSP00000346464	0.684	Vacuolar protein sorting-associated protein 72 homolog
11	9606.ENSP00000263062	0.681	Enhancer of polycomb homolog 1
12	9606.ENSP00000264444	0.650	Max dimerization protein 1
13	9606.ENSP00000368959	0.630	Receptor expression-enhancing protein 5
14	9606.ENSP00000269305	0.615	Cellular tumor antigen p53
15	9606.ENSP00000375960	0.613	Afadin
16	9606.ENSP00000309653	0.584	Zinc finger protein GLIS1
17	9606.ENSP00000361834	0.579	Collagen alpha-2(IX) chain
18	9606.ENSP00000365172	0.575	KDEL motif-containing protein 1
19	9606.ENSP00000229307	0.573	Homeobox protein NANOG
20	9606.ENSP00000269141	0.571	Cadherin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.997	DNA binding
GO:0140110	0.977	transcription regulator activity
GO:0003700	0.954	DNA-binding transcription factor activity
GO:0043565	0.847	sequence-specific DNA binding
GO:0003690	0.666	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0051239	0.893	regulation of multicellular organismal process
GO:0050793	0.891	regulation of developmental process
GO:2000026	0.811	regulation of multicellular organismal development
GO:0045595	0.779	regulation of cell differentiation
GO:0019222	0.775	regulation of metabolic process
GO:0080090	0.766	regulation of primary metabolic process
GO:0031323	0.766	regulation of cellular metabolic process
GO:0051171	0.753	regulation of nitrogen compound metabolic process
GO:0060255	0.718	regulation of macromolecule metabolic process
GO:0045682	0.685	regulation of epidermis development
GO:0009987	0.681	cellular process
GO:0009889	0.612	regulation of biosynthetic process
GO:0019219	0.607	regulation of nucleobase-containing compound metabolic process
GO:0030856	0.601	regulation of epithelial cell differentiation
GO:0010556	0.569	regulation of macromolecule biosynthetic process
GO:0031326	0.569	regulation of cellular biosynthetic process
GO:0010468	0.563	regulation of gene expression
GO:0048518	0.552	positive regulation of biological process
GO:0006355	0.546	regulation of DNA-templated transcription
GO:0045664	0.544	regulation of neuron differentiation
GO:0048522	0.530	positive regulation of cellular process
GO:0009893	0.447	positive regulation of metabolic process
GO:0010604	0.442	positive regulation of macromolecule metabolic process
GO:0048519	0.424	negative regulation of biological process
GO:0031325	0.415	positive regulation of cellular metabolic process
GO:0048523	0.357	negative regulation of cellular process
GO:0051173	0.356	positive regulation of nitrogen compound metabolic process
GO:0006357	0.308	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0032991	0.864	protein-containing complex
GO:0005694	0.821	chromosome
GO:0000785	0.320	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]