StarFunc result for job id P12525

User Input

>input (358 residues)
MDRDSYHHYFYDYDGGEDFYRSTTPSEDIWKKFELVPPPWDLGPAAGNPALSFGLLEPWP
VGCAGDETESQDYWKAWDANYASLIRRDCMWSGFSTQEPLERAVSDLLAVGAPSGYSPKE
FATPDYTPELEAGNLAPIFPCLLGEPKIQACSRSESPSDSEGEEIDVTVKKRQSLSTRKP
VIIAVRADLLDPRMNLFHISIHQQQHNYAAPFPPESCFQEGAPKRMPPKEALEREAPGGK
DDKEDEEIVSLPPVESEAAQSCQPKPIHYDTENWTKKKYHSYLERKRRNDQRSRFLALRD
EVPALASCSRVSKVMILVKATEYLHELAEAEERMATEKRQLECQRRQLQKRIEYLSSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12525	0.999	0.999	6.645E-56	358	1.000	1.000	P12525.pdb.gz	MYCP1_HUMAN Putative myc-like protein MYCLP1 OS=Homo sapiens OX=9606 GN=MYCLP1 PE=5 SV=2
2	AFDB:P10166	0.338	0.330	4.149E-35	368	0.704	0.685	P10166.pdb.gz	MYCL_MOUSE Protein L-Myc OS=Mus musculus OX=10090 GN=Mycl PE=2 SV=1
3	AFDB:A0A087WUS5	0.270	0.214	2.493E-12	454	0.307	0.242	A0A087WUS5.pdb.gz
4	AFDB:A0A1W2PPD9	0.276	0.387	4.145E-7	253	0.215	0.304	A0A1W2PPD9.pdb.gz	A0A1W2PPD9_HUMAN MYCN proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=1
5	AFDB:Q8C6A8	0.198	0.200	4.694E-3	355	0.131	0.132	Q8C6A8.pdb.gz	BHE22_MOUSE Class E basic helix-loop-helix protein 22 OS=Mus musculus OX=10090 GN=Bhlhe22 PE=1 SV=1
6	AFDB:Q9SVU6	0.187	0.163	5.742E-3	413	0.134	0.116	Q9SVU6.pdb.gz	BH023_ARATH Transcription factor bHLH23 OS=Arabidopsis thaliana OX=3702 GN=BHLH23 PE=2 SV=1
7	AFDB:Q04635	0.203	0.177	3.292E-2	413	0.190	0.165	Q04635.pdb.gz	ESC1_SCHPO Protein esc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=esc1 PE=2 SV=1
8	AFDB:Q9HAP2	0.244	0.100	4.026E-2	919	0.179	0.070	Q9HAP2.pdb.gz	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
9	AFDB:Q06507	0.108	0.111	6.024E-2	349	0.187	0.192	Q06507.pdb.gz	ATF4_MOUSE Cyclic AMP-dependent transcription factor ATF-4 OS=Mus musculus OX=10090 GN=Atf4 PE=1 SV=2
10	AFDB:O75069	0.121	0.066	7.881E-2	709	0.168	0.085	O75069.pdb.gz	TMCC2_HUMAN Transmembrane and coiled-coil domains protein 2 OS=Homo sapiens OX=9606 GN=TMCC2 PE=1 SV=3
11	PDB:2bskD	0.118	0.390	3.680	90	0.047	0.189	2bskD.pdb.gz
12	PDB:7qfqA	0.061	0.020	7.704	1291	0.014	0.004	7qfqA.pdb.gz
13	PDB:5w7gB	0.061	0.130	8.239	126	0.025	0.071	5w7gB.pdb.gz	Model for a novel membrane envelope in a filamentous hyperthermophilic virus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12525	0.0	740	358	1.000	1.000	MYCP1_HUMAN Putative myc-like protein MYCLP1 OS=Homo sapiens OX=9606 GN=MYCLP1 PE=5 SV=2
2	P12524	3.01e-168	475	364	0.726	0.714	MYCL_HUMAN Protein L-Myc OS=Homo sapiens OX=9606 GN=MYCL PE=1 SV=2
3	P10166	2.75e-157	447	368	0.701	0.682	MYCL_MOUSE Protein L-Myc OS=Mus musculus OX=10090 GN=Mycl PE=2 SV=1
4	E9PQS5	4.72e-44	149	100	0.201	0.720	E9PQS5_HUMAN MYCL proto-oncogene, bHLH transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=MYCL PE=4 SV=1
5	Q7ZVS9	5.02e-30	120	396	0.349	0.316	MYCB_DANRE Transcriptional regulator Myc-B OS=Danio rerio OX=7955 GN=mycb PE=2 SV=1
6	A0A060WAZ1	5.43e-27	112	406	0.349	0.308	A0A060WAZ1_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065805001 PE=4 SV=1
7	Q2L4Q4	7.40e-27	112	407	0.349	0.307	Q2L4Q4_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=myc PE=2 SV=1
8	P03966	5.52e-22	99.0	462	0.209	0.162	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2
9	A0A1W2PPD9	2.76e-21	93.6	253	0.209	0.296	A0A1W2PPD9_HUMAN MYCN proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=1
10	P04198	3.37e-21	96.7	464	0.207	0.159	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
11	P01109	9.31e-16	80.1	416	0.154	0.132	MYC_CHICK Myc proto-oncogene protein OS=Gallus gallus OX=9031 GN=MYC PE=1 SV=2
12	P06646	2.51e-15	79.0	414	0.173	0.150	MYC_ONCMY Transcriptional regulator Myc (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=myc PE=3 SV=1
13	P01108	2.26e-14	76.3	439	0.148	0.121	MYC_MOUSE Myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Myc PE=1 SV=2
14	Q28350	4.53e-14	75.1	439	0.145	0.118	MYC_CANLF Myc proto-oncogene protein OS=Canis lupus familiaris OX=9615 GN=MYC PE=2 SV=2
15	P09416	4.65e-14	75.1	439	0.148	0.121	MYC_RAT Myc proto-oncogene protein OS=Rattus norvegicus OX=10116 GN=Myc PE=1 SV=2
16	P52160	5.24e-14	74.7	408	0.145	0.127	MYCA_DANRE Transcriptional regulator Myc-A OS=Danio rerio OX=7955 GN=myca PE=2 SV=3
17	P01106	6.29e-14	74.7	439	0.142	0.116	MYC_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=2
18	A0A494C1T8	9.83e-14	73.6	339	0.142	0.150	A0A494C1T8_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1
19	B2KUA9	2.85e-10	63.2	360	0.179	0.178	B2KUA9_DANRE Transcriptional regulator OS=Danio rerio OX=7955 GN=id:ibd5144 PE=2 SV=1
20	P52161	1.23e-05	47.4	165	0.070	0.152	MAX_DANRE Protein max OS=Danio rerio OX=7955 GN=max PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	4.2e-08	44.4	Helix-loop-helix DNA-binding domain
2	PF01056 Myc_N	6.8e-21	87.0	Myc amino-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008971341.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003824094.1	0.708	MYC associated factor X
2	9597.XP_003830981.1	0.519	Max dimerization protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0005488	0.995	binding
GO:0005515	0.994	protein binding
GO:0003677	0.962	DNA binding
GO:0043565	0.928	sequence-specific DNA binding
GO:0003690	0.843	double-stranded DNA binding
GO:1990837	0.723	sequence-specific double-stranded DNA binding
GO:0000976	0.690	transcription cis-regulatory region binding
GO:0000987	0.413	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.405	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.385	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.337	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.977	regulation of biological process
GO:0050794	0.963	regulation of cellular process
GO:0019222	0.586	regulation of metabolic process
GO:0060255	0.582	regulation of macromolecule metabolic process
GO:0080090	0.572	regulation of primary metabolic process
GO:0051171	0.570	regulation of nitrogen compound metabolic process
GO:0031323	0.569	regulation of cellular metabolic process
GO:0019219	0.533	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.521	regulation of gene expression
GO:0009987	0.481	cellular process
GO:2001141	0.479	regulation of RNA biosynthetic process
GO:1903506	0.466	regulation of nucleic acid-templated transcription
GO:0006355	0.461	regulation of DNA-templated transcription
GO:0048518	0.423	positive regulation of biological process
GO:0048522	0.332	positive regulation of cellular process
GO:0048519	0.307	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005694	0.945	chromosome
GO:0032991	0.572	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]