StarFunc result for job id P12643

User Input

>input (396 residues)
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C8C060	0.907	0.907	3.719E-71	396	1.000	1.000	C8C060.pdb.gz	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
2	AFDB:Q90751	0.858	0.961	7.247E-58	353	0.730	0.819	Q90751.pdb.gz	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
3	AFDB:A0A0B5GTK3	0.865	0.887	1.294E-54	386	0.639	0.655	A0A0B5GTK3.pdb.gz
4	AFDB:Q90752	0.814	0.796	7.048E-50	405	0.624	0.610	Q90752.pdb.gz	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
5	AFDB:P12644	0.822	0.799	7.856E-50	408	0.614	0.596	P12644.pdb.gz	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
6	AFDB:O13108	0.815	0.786	9.530E-49	411	0.614	0.591	O13108.pdb.gz
7	AFDB:F1QAD6	0.830	0.822	9.825E-48	400	0.593	0.588	F1QAD6.pdb.gz
8	AFDB:P07713	0.711	0.492	4.394E-37	588	0.396	0.267	P07713.pdb.gz	DECA_DROME Protein decapentaplegic OS=Drosophila melanogaster OX=7227 GN=dpp PE=1 SV=2
9	AFDB:A0A0B5GNT7	0.739	0.705	4.190E-35	416	0.409	0.389	A0A0B5GNT7.pdb.gz
10	AFDB:F1P4H2	0.707	0.649	8.338E-32	434	0.343	0.313	F1P4H2.pdb.gz
11	PDB:5hlyA	0.266	0.332	3.626E-16	299	0.205	0.271	5hlyA.pdb.gz
12	PDB:5ntuA	0.263	0.324	1.408E-15	308	0.207	0.266	5ntuA.pdb.gz
13	PDB:6umxA	0.343	0.463	8.905E-15	279	0.187	0.265	6umxA.pdb.gz
14	PDB:5nxsA	0.280	0.367	2.365E-14	290	0.197	0.269	5nxsA.pdb.gz
15	PDB:3rjrC	0.285	0.323	1.496E-13	343	0.217	0.251	3rjrC.pdb.gz
16	PDB:5vqfB	0.279	0.332	6.473E-13	320	0.197	0.244	5vqfB.pdb.gz
17	PDB:5ffoG	0.289	0.370	1.030E-11	297	0.182	0.242	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.277	0.344	1.679E-11	308	0.194	0.250	7y1rB.pdb.gz
19	PDB:5nxsB	0.254	0.388	2.530E-10	251	0.179	0.283	5nxsB.pdb.gz
20	PDB:6q2sA	0.168	0.537	1.058E-3	98	0.048	0.194	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C8C060	0.0	825	396	1.000	1.000	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
2	O13109	0.0	517	386	0.631	0.648	O13109_DANRE BMP2 OS=Danio rerio OX=7955 GN=BMP2 PE=2 SV=1
3	P12643	0.0	825	396	1.000	1.000	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
4	P21274	0.0	741	394	0.919	0.924	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
5	P49001	0.0	736	393	0.914	0.921	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
6	Q90751	0.0	596	353	0.727	0.816	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
7	A5HMF9	5.26e-180	508	404	0.639	0.626	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
8	A5HMF8	3.32e-178	503	404	0.636	0.624	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
9	Q90752	5.12e-177	500	405	0.639	0.625	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
10	P12644	1.01e-173	492	408	0.652	0.632	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
11	O93369	1.95e-173	491	411	0.677	0.652	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
12	Q06826	6.47e-172	488	408	0.652	0.632	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1
13	P21275	7.56e-171	485	408	0.649	0.630	BMP4_MOUSE Bone morphogenetic protein 4 OS=Mus musculus OX=10090 GN=Bmp4 PE=1 SV=2
14	O57574	3.12e-168	478	400	0.619	0.613	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
15	Q8MKC2	2.64e-155	438	223	0.525	0.933	Q8MKC2_SHEEP Bone morphogenetic protein 2 (Fragment) OS=Ovis aries OX=9940 PE=2 SV=1
16	P07713	1.89e-89	283	588	0.407	0.274	DECA_DROME Protein decapentaplegic OS=Drosophila melanogaster OX=7227 GN=dpp PE=1 SV=2
17	D2TEB7	1.80e-84	265	416	0.407	0.387	D2TEB7_DANRE Bone morphogenetic protein 16 OS=Danio rerio OX=7955 GN=bmp16 PE=2 SV=1
18	Q8UVQ2	3.95e-64	212	391	0.333	0.338	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
19	Q9PTF9	1.36e-61	206	432	0.333	0.306	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
20	G3V6W8	1.02e-56	193	430	0.316	0.291	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	1.3e-48	177.4	TGF-beta propeptide
2	PF00019 TGF_beta	5.9e-32	122.0	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368104

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241416	0.999	Activin receptor type-2A
2	9606.ENSP00000308219	0.999	RGM domain family member B
3	9606.ENSP00000328181	0.999	Noggin
4	9606.ENSP00000337014	0.999	Hemojuvelin
5	9606.ENSP00000340361	0.999	Activin receptor type-2B
6	9606.ENSP00000361107	0.999	Bone morphogenetic protein receptor type-1A
7	9606.ENSP00000363708	0.999	Bone morphogenetic protein receptor type-2
8	9606.ENSP00000204604	0.998	Chordin
9	9606.ENSP00000401907	0.998	Bone morphogenetic protein receptor type-1B
10	9606.ENSP00000452126	0.998	Repulsive guidance molecule A
11	9606.ENSP00000478319	0.996	Gremlin-1
12	9606.ENSP00000263640	0.995	Activin receptor type-1
13	9606.ENSP00000341551	0.989	Mothers against decapentaplegic homolog 4
14	9606.ENSP00000360493	0.989	Runt-related transcription factor 2
15	9606.ENSP00000441954	0.987	Mothers against decapentaplegic homolog 5
16	9606.ENSP00000369154	0.978	Mothers against decapentaplegic homolog 9
17	9606.ENSP00000228938	0.974	Matrix Gla protein
18	9606.ENSP00000426568	0.973	Mothers against decapentaplegic homolog 1
19	9606.ENSP00000256759	0.972	Follistatin
20	9606.ENSP00000262158	0.972	Mothers against decapentaplegic homolog 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0140677	0.999	molecular function activator activity
GO:0030546	0.986	signaling receptor activator activity
GO:0048018	0.976	receptor ligand activity
GO:0042802	0.651	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.998	multicellular organismal process
GO:0048856	0.998	anatomical structure development
GO:0045595	0.998	regulation of cell differentiation
GO:0048519	0.997	negative regulation of biological process
GO:0048522	0.997	positive regulation of cellular process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0070848	0.995	response to growth factor
GO:0051239	0.995	regulation of multicellular organismal process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0048584	0.995	positive regulation of response to stimulus
GO:0031323	0.995	regulation of cellular metabolic process
GO:0007167	0.995	enzyme-linked receptor protein signaling pathway
GO:0051093	0.992	negative regulation of developmental process
GO:0048523	0.992	negative regulation of cellular process
GO:0048869	0.991	cellular developmental process
GO:0023051	0.991	regulation of signaling
GO:0010646	0.991	regulation of cell communication
GO:0007275	0.989	multicellular organism development
GO:0051240	0.989	positive regulation of multicellular organismal process
GO:0010468	0.988	regulation of gene expression
GO:0045597	0.988	positive regulation of cell differentiation
GO:0042127	0.987	regulation of cell population proliferation
GO:2000026	0.987	regulation of multicellular organismal development
GO:0009893	0.987	positive regulation of metabolic process
GO:0009889	0.986	regulation of biosynthetic process
GO:0071363	0.985	cellular response to growth factor stimulus
GO:0048513	0.982	animal organ development
GO:0090100	0.982	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0045596	0.981	negative regulation of cell differentiation
GO:0030509	0.979	BMP signaling pathway
GO:0061035	0.969	regulation of cartilage development
GO:0008284	0.967	positive regulation of cell population proliferation
GO:0019219	0.967	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.966	regulation of cellular biosynthetic process
GO:0001503	0.963	ossification
GO:0010556	0.963	regulation of macromolecule biosynthetic process
GO:0051173	0.962	positive regulation of nitrogen compound metabolic process
GO:0031325	0.962	positive regulation of cellular metabolic process
GO:0001501	0.956	skeletal system development
GO:0051252	0.956	regulation of RNA metabolic process
GO:0051174	0.954	regulation of phosphorus metabolic process
GO:0010717	0.952	regulation of epithelial to mesenchymal transition
GO:0001649	0.946	osteoblast differentiation
GO:0070167	0.944	regulation of biomineral tissue development
GO:0030278	0.941	regulation of ossification
GO:0001932	0.940	regulation of protein phosphorylation
GO:0043408	0.937	regulation of MAPK cascade
GO:0060393	0.932	regulation of pathway-restricted SMAD protein phosphorylation
GO:0006355	0.928	regulation of DNA-templated transcription
GO:0045778	0.924	positive regulation of ossification
GO:0010557	0.922	positive regulation of macromolecule biosynthetic process
GO:0009888	0.916	tissue development
GO:0051241	0.916	negative regulation of multicellular organismal process
GO:0009653	0.913	anatomical structure morphogenesis
GO:0045893	0.892	positive regulation of DNA-templated transcription
GO:0072359	0.888	circulatory system development
GO:0061036	0.888	positive regulation of cartilage development
GO:0010718	0.885	positive regulation of epithelial to mesenchymal transition
GO:0071704	0.855	organic substance metabolic process
GO:0006807	0.854	nitrogen compound metabolic process
GO:0006357	0.851	regulation of transcription by RNA polymerase II
GO:0009887	0.843	animal organ morphogenesis
GO:0090287	0.833	regulation of cellular response to growth factor stimulus
GO:0044237	0.815	cellular metabolic process
GO:0045944	0.784	positive regulation of transcription by RNA polymerase II
GO:0030334	0.778	regulation of cell migration
GO:0009892	0.765	negative regulation of metabolic process
GO:0010605	0.754	negative regulation of macromolecule metabolic process
GO:0051247	0.753	positive regulation of protein metabolic process
GO:0042221	0.748	response to chemical
GO:0065009	0.740	regulation of molecular function
GO:0051172	0.739	negative regulation of nitrogen compound metabolic process
GO:0031324	0.739	negative regulation of cellular metabolic process
GO:0043170	0.737	macromolecule metabolic process
GO:0010033	0.703	response to organic substance
GO:0044238	0.698	primary metabolic process
GO:0048585	0.692	negative regulation of response to stimulus
GO:0009605	0.685	response to external stimulus
GO:0009628	0.669	response to abiotic stimulus
GO:0035295	0.655	tube development
GO:0060485	0.642	mesenchyme development
GO:0000003	0.631	reproduction
GO:0007507	0.626	heart development
GO:0007399	0.591	nervous system development
GO:0048468	0.580	cell development
GO:0048646	0.562	anatomical structure formation involved in morphogenesis
GO:0060429	0.534	epithelium development
GO:0035239	0.502	tube morphogenesis
GO:0072001	0.455	renal system development
GO:0003007	0.446	heart morphogenesis
GO:0009790	0.419	embryo development
GO:0002009	0.402	morphogenesis of an epithelium
GO:0048598	0.390	embryonic morphogenesis
GO:0060562	0.373	epithelial tube morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005615	0.997	extracellular space
GO:0071944	0.979	cell periphery
GO:0005622	0.977	intracellular anatomical structure
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0070013	0.956	intracellular organelle lumen
GO:0016020	0.951	membrane
GO:0005737	0.930	cytoplasm
GO:0005886	0.920	plasma membrane
GO:0032991	0.915	protein-containing complex
GO:0031982	0.581	vesicle
GO:0005654	0.302	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]