StarFunc result for job id P12644

User Input

>input (408 residues)
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSF
HHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINI
YEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTH
LHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12644	1.000	1.000	2.547E-79	408	1.000	1.000	P12644.pdb.gz	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
2	AFDB:Q90752	0.932	0.939	7.458E-65	405	0.841	0.847	Q90752.pdb.gz	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
3	AFDB:F1QAD6	0.854	0.870	6.245E-58	400	0.708	0.723	F1QAD6.pdb.gz
4	AFDB:C8C060	0.809	0.832	7.730E-50	396	0.625	0.644	C8C060.pdb.gz	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
5	AFDB:Q90751	0.800	0.920	2.606E-48	353	0.566	0.654	Q90751.pdb.gz	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
6	AFDB:A0A0B5GTK3	0.806	0.849	2.927E-47	386	0.520	0.549	A0A0B5GTK3.pdb.gz
7	AFDB:O13108	0.812	0.806	7.138E-45	411	0.559	0.555	O13108.pdb.gz
8	AFDB:P07713	0.694	0.492	6.712E-37	588	0.400	0.277	P07713.pdb.gz	DECA_DROME Protein decapentaplegic OS=Drosophila melanogaster OX=7227 GN=dpp PE=1 SV=2
9	AFDB:A0A0B5GNT7	0.714	0.701	8.943E-35	416	0.380	0.373	A0A0B5GNT7.pdb.gz
10	AFDB:F1P4H2	0.665	0.628	1.199E-31	434	0.326	0.306	F1P4H2.pdb.gz
11	PDB:5hlyA	0.270	0.349	2.397E-15	299	0.211	0.288	5hlyA.pdb.gz
12	PDB:5ntuA	0.262	0.338	2.533E-15	308	0.194	0.256	5ntuA.pdb.gz
13	PDB:6umxA	0.305	0.421	4.899E-15	279	0.184	0.269	6umxA.pdb.gz
14	PDB:5nxsA	0.269	0.366	1.318E-14	290	0.184	0.259	5nxsA.pdb.gz
15	PDB:3rjrC	0.276	0.318	1.326E-13	343	0.208	0.248	3rjrC.pdb.gz
16	PDB:5vqfB	0.265	0.327	1.563E-13	320	0.211	0.269	5vqfB.pdb.gz
17	PDB:5ffoG	0.287	0.379	5.568E-12	297	0.186	0.256	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.260	0.329	6.566E-12	308	0.189	0.250	7y1rB.pdb.gz
19	PDB:5nxsB	0.217	0.341	2.339E-10	251	0.169	0.275	5nxsB.pdb.gz
20	PDB:6q2sA	0.163	0.536	3.765E-4	98	0.051	0.214	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5HMF8	0.0	694	404	0.836	0.844	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
2	A5HMF9	0.0	699	404	0.838	0.847	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
3	O57574	0.0	583	400	0.708	0.723	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
4	P12644	0.0	851	408	1.000	1.000	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
5	P21275	0.0	822	408	0.973	0.973	BMP4_MOUSE Bone morphogenetic protein 4 OS=Mus musculus OX=10090 GN=Bmp4 PE=1 SV=2
6	Q06826	0.0	816	408	0.966	0.966	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1
7	Q90752	0.0	702	405	0.841	0.847	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
8	C8C060	6.33e-167	475	396	0.632	0.652	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
9	P12643	6.33e-167	475	396	0.632	0.652	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
10	P21274	8.15e-165	469	394	0.618	0.640	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
11	P49001	5.59e-161	460	393	0.615	0.639	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
12	Q90751	9.57e-161	457	353	0.574	0.663	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
13	O13109	9.18e-155	444	386	0.542	0.573	O13109_DANRE BMP2 OS=Danio rerio OX=7955 GN=BMP2 PE=2 SV=1
14	O93369	1.59e-151	436	411	0.559	0.555	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
15	Q8MKC2	1.57e-97	292	223	0.360	0.659	Q8MKC2_SHEEP Bone morphogenetic protein 2 (Fragment) OS=Ovis aries OX=9940 PE=2 SV=1
16	P07713	2.61e-90	286	588	0.409	0.284	DECA_DROME Protein decapentaplegic OS=Drosophila melanogaster OX=7227 GN=dpp PE=1 SV=2
17	D2TEB7	3.27e-79	252	416	0.368	0.361	D2TEB7_DANRE Bone morphogenetic protein 16 OS=Danio rerio OX=7955 GN=bmp16 PE=2 SV=1
18	Q8UVQ2	3.01e-56	191	391	0.304	0.317	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
19	G3V6W8	5.26e-56	192	430	0.311	0.295	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
20	P23359	5.26e-56	192	430	0.311	0.295	BMP7_MOUSE Bone morphogenetic protein 7 OS=Mus musculus OX=10090 GN=Bmp7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	2.2e-50	183.2	TGF-beta propeptide
2	PF00019 TGF_beta	3.8e-31	119.4	Transforming growth factor beta like domain
3	PF14706 Tnp_DNA_bind	81	14.5	Transposase DNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245451

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204604	0.999	Chordin
2	9606.ENSP00000361107	0.999	Bone morphogenetic protein receptor type-1A
3	9606.ENSP00000363708	0.999	Bone morphogenetic protein receptor type-2
4	9606.ENSP00000401907	0.999	Bone morphogenetic protein receptor type-1B
5	9606.ENSP00000328181	0.998	Noggin
6	9606.ENSP00000263640	0.997	Activin receptor type-1
7	9606.ENSP00000478319	0.991	Gremlin-1
8	9606.ENSP00000441954	0.988	Mothers against decapentaplegic homolog 5
9	9606.ENSP00000356954	0.984	Connective tissue growth factor
10	9606.ENSP00000369154	0.981	Mothers against decapentaplegic homolog 9
11	9606.ENSP00000327758	0.979	Homeobox protein Nkx-2.5
12	9606.ENSP00000256759	0.977	Follistatin
13	9606.ENSP00000334458	0.977	Transcription factor GATA-4
14	9606.ENSP00000426568	0.976	Mothers against decapentaplegic homolog 1
15	9606.ENSP00000452126	0.974	Repulsive guidance molecule A
16	9606.ENSP00000262158	0.972	Mothers against decapentaplegic homolog 7
17	9606.ENSP00000241416	0.967	Activin receptor type-2A
18	9606.ENSP00000340361	0.966	Activin receptor type-2B
19	9606.ENSP00000361112	0.966	Chordin-like protein 1
20	9606.ENSP00000341551	0.964	Mothers against decapentaplegic homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.996	signaling receptor binding
GO:0140677	0.985	molecular function activator activity
GO:0030545	0.965	signaling receptor regulator activity
GO:0048018	0.959	receptor ligand activity
GO:0042802	0.617	identical protein binding
GO:0042056	0.384	chemoattractant activity
GO:0070696	0.326	transmembrane receptor protein serine/threonine kinase binding
GO:0005125	0.323	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0032501	0.996	multicellular organismal process
GO:0009987	0.996	cellular process
GO:0048856	0.996	anatomical structure development
GO:0048523	0.995	negative regulation of cellular process
GO:0009653	0.992	anatomical structure morphogenesis
GO:0051093	0.992	negative regulation of developmental process
GO:0035295	0.992	tube development
GO:0048513	0.991	animal organ development
GO:0009888	0.991	tissue development
GO:0048522	0.991	positive regulation of cellular process
GO:0042127	0.990	regulation of cell population proliferation
GO:0030509	0.985	BMP signaling pathway
GO:0060795	0.982	cell fate commitment involved in formation of primary germ layer
GO:0045595	0.981	regulation of cell differentiation
GO:0001655	0.975	urogenital system development
GO:0001822	0.975	kidney development
GO:0001710	0.974	mesodermal cell fate commitment
GO:0060429	0.968	epithelium development
GO:0045596	0.968	negative regulation of cell differentiation
GO:0007507	0.967	heart development
GO:0045597	0.964	positive regulation of cell differentiation
GO:0008284	0.962	positive regulation of cell population proliferation
GO:0090092	0.961	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009887	0.960	animal organ morphogenesis
GO:0001763	0.959	morphogenesis of a branching structure
GO:0060562	0.959	epithelial tube morphogenesis
GO:0061311	0.956	cell surface receptor signaling pathway involved in heart development
GO:0090100	0.954	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0080090	0.952	regulation of primary metabolic process
GO:0051171	0.952	regulation of nitrogen compound metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0048732	0.951	gland development
GO:0010468	0.946	regulation of gene expression
GO:0009893	0.937	positive regulation of metabolic process
GO:0010604	0.924	positive regulation of macromolecule metabolic process
GO:0009889	0.920	regulation of biosynthetic process
GO:0019219	0.917	regulation of nucleobase-containing compound metabolic process
GO:0001823	0.914	mesonephros development
GO:0001501	0.908	skeletal system development
GO:0031326	0.907	regulation of cellular biosynthetic process
GO:0010556	0.905	regulation of macromolecule biosynthetic process
GO:0051239	0.900	regulation of multicellular organismal process
GO:0051252	0.896	regulation of RNA metabolic process
GO:0051173	0.893	positive regulation of nitrogen compound metabolic process
GO:0006355	0.889	regulation of DNA-templated transcription
GO:0031325	0.886	positive regulation of cellular metabolic process
GO:0001657	0.885	ureteric bud development
GO:0048468	0.854	cell development
GO:0051240	0.838	positive regulation of multicellular organismal process
GO:0010453	0.827	regulation of cell fate commitment
GO:2000026	0.816	regulation of multicellular organismal development
GO:0090287	0.801	regulation of cellular response to growth factor stimulus
GO:0072009	0.795	nephron epithelium development
GO:0072088	0.785	nephron epithelium morphogenesis
GO:0060675	0.780	ureteric bud morphogenesis
GO:0003007	0.770	heart morphogenesis
GO:0060485	0.767	mesenchyme development
GO:0051254	0.766	positive regulation of RNA metabolic process
GO:0030334	0.759	regulation of cell migration
GO:0009891	0.755	positive regulation of biosynthetic process
GO:0045893	0.752	positive regulation of DNA-templated transcription
GO:0019220	0.713	regulation of phosphate metabolic process
GO:0042325	0.703	regulation of phosphorylation
GO:0045944	0.702	positive regulation of transcription by RNA polymerase II
GO:0042221	0.683	response to chemical
GO:0031399	0.673	regulation of protein modification process
GO:0008152	0.669	metabolic process
GO:1901700	0.638	response to oxygen-containing compound
GO:1902531	0.637	regulation of intracellular signal transduction
GO:0007399	0.585	nervous system development
GO:0010033	0.571	response to organic substance
GO:0000003	0.567	reproduction
GO:0007423	0.525	sensory organ development
GO:0009892	0.491	negative regulation of metabolic process
GO:0044237	0.460	cellular metabolic process
GO:0035148	0.439	tube formation
GO:0051247	0.421	positive regulation of protein metabolic process
GO:0007389	0.407	pattern specification process
GO:0007417	0.401	central nervous system development
GO:0007420	0.388	brain development
GO:0048568	0.387	embryonic organ development
GO:0072175	0.379	epithelial tube formation
GO:0003002	0.370	regionalization
GO:0071704	0.353	organic substance metabolic process
GO:0044238	0.343	primary metabolic process
GO:0010605	0.336	negative regulation of macromolecule metabolic process
GO:0065009	0.318	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.975	intracellular anatomical structure
GO:0043227	0.968	membrane-bounded organelle
GO:0070013	0.945	intracellular organelle lumen
GO:0043231	0.929	intracellular membrane-bounded organelle
GO:0005737	0.806	cytoplasm
GO:0031982	0.371	vesicle
GO:0012505	0.306	endomembrane system
GO:0032991	0.303	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]