StarFunc result for job id P12645

User Input

>input (472 residues)
MAGASRLLFLWLGCFCVSLAQGERPKPPFPELRKAVPGDRTAGGGPDSELQPQDKVSEHM
LRLYDRYSTVQAARTPGSLEGGSQPWRPRLLREGNTVRSFRAAAAETLERKGLYIFNLTS
LTKSENILSATLYFCIGELGNISLSCPVSGGCSHHAQRKHIQIDLSAWTLKFSRNQSQLL
GHLSVDMAKSHRDIMSWLSKDITQLLRKAKENEEFLIGFNITSKGRQLPKRRLPFPEPYI
LVYANDAAISEPESVVSSLQGHRNFPTGTVPKWDSHIRAALSIERRKKRSTGVLLPLQNN
ELPGAEYQYKKDEVWEERKPYKTLQAQAPEKSKNKKKQRKGPHRKSQTLQFDEQTLKKAR
RKQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQ
SIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12645	1.000	1.000	5.303E-85	472	1.000	1.000	P12645.pdb.gz	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
2	AFDB:P49002	0.737	0.743	1.456E-65	468	0.799	0.806	P49002.pdb.gz	BMP3_RAT Bone morphogenetic protein 3 OS=Rattus norvegicus OX=10116 GN=Bmp3 PE=2 SV=1
3	AFDB:A0JML2	0.647	0.673	5.082E-49	452	0.525	0.549	A0JML2.pdb.gz	A0JML2_DANRE Bone morphogenetic protein 3 OS=Danio rerio OX=7955 GN=zgc:153939 PE=2 SV=1
4	AFDB:P55107	0.624	0.616	3.166E-44	478	0.453	0.448	P55107.pdb.gz	GDF10_HUMAN Growth/differentiation factor 10 OS=Homo sapiens OX=9606 GN=GDF10 PE=2 SV=1
5	AFDB:P55108	0.586	0.581	4.831E-42	476	0.445	0.441	P55108.pdb.gz	GDF10_RAT Growth/differentiation factor 10 OS=Rattus norvegicus OX=10116 GN=Gdf10 PE=2 SV=1
6	AFDB:Q7T2X6	0.615	0.653	4.508E-40	443	0.409	0.436	Q7T2X6.pdb.gz	GDF10_XENLA Growth/differentiation factor 10 OS=Xenopus laevis OX=8355 GN=gdf10 PE=1 SV=1
7	AFDB:F1R5Z7	0.438	0.518	2.611E-25	391	0.248	0.299	F1R5Z7.pdb.gz
8	AFDB:P43029	0.502	0.512	3.077E-25	461	0.216	0.221	P43029.pdb.gz	GDF7_MOUSE Growth/differentiation factor 7 OS=Mus musculus OX=10090 GN=Gdf7 PE=2 SV=2
9	AFDB:A0A0B5GNT7	0.464	0.520	4.764E-25	416	0.212	0.240	A0A0B5GNT7.pdb.gz
10	AFDB:F1NUT2	0.480	0.487	1.081E-24	465	0.214	0.217	F1NUT2.pdb.gz
11	PDB:5ntuA	0.223	0.313	6.678E-13	308	0.150	0.231	5ntuA.pdb.gz
12	PDB:5nxsA	0.222	0.330	6.630E-12	290	0.144	0.234	5nxsA.pdb.gz
13	PDB:5hlyA	0.229	0.337	3.062E-11	299	0.119	0.187	5hlyA.pdb.gz
14	PDB:6umxA	0.239	0.361	5.008E-11	279	0.138	0.233	6umxA.pdb.gz
15	PDB:5vqfB	0.218	0.302	2.443E-10	320	0.148	0.219	5vqfB.pdb.gz
16	PDB:3rjrC	0.220	0.286	3.211E-10	343	0.148	0.204	3rjrC.pdb.gz
17	PDB:5ffoG	0.231	0.345	8.072E-9	297	0.148	0.236	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.199	0.290	2.280E-8	308	0.163	0.250	7y1rB.pdb.gz
19	PDB:5nxsB	0.179	0.305	3.505E-7	251	0.125	0.235	5nxsB.pdb.gz
20	PDB:6q2sA	0.146	0.540	5.064E-5	98	0.053	0.255	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12645	0.0	979	472	1.000	1.000	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
2	P49002	0.0	751	468	0.809	0.816	BMP3_RAT Bone morphogenetic protein 3 OS=Rattus norvegicus OX=10116 GN=Bmp3 PE=2 SV=1
3	Q8BHE5	0.0	760	468	0.799	0.806	BMP3_MOUSE Bone morphogenetic protein 3 OS=Mus musculus OX=10090 GN=Bmp3 PE=1 SV=1
4	A0JML2	4.86e-168	483	452	0.542	0.566	A0JML2_DANRE Bone morphogenetic protein 3 OS=Danio rerio OX=7955 GN=zgc:153939 PE=2 SV=1
5	P55108	8.87e-118	355	476	0.439	0.435	GDF10_RAT Growth/differentiation factor 10 OS=Rattus norvegicus OX=10116 GN=Gdf10 PE=2 SV=1
6	P55107	8.58e-117	353	478	0.456	0.450	GDF10_HUMAN Growth/differentiation factor 10 OS=Homo sapiens OX=9606 GN=GDF10 PE=2 SV=1
7	P97737	6.65e-116	350	476	0.441	0.437	GDF10_MOUSE Growth/differentiation factor 10 OS=Mus musculus OX=10090 GN=Gdf10 PE=1 SV=2
8	Q7T2X6	1.07e-104	321	443	0.436	0.465	GDF10_XENLA Growth/differentiation factor 10 OS=Xenopus laevis OX=8355 GN=gdf10 PE=1 SV=1
9	Q8UVQ2	3.56e-36	139	391	0.125	0.151	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
10	O57574	6.69e-32	128	400	0.108	0.128	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
11	O93369	1.12e-31	127	411	0.112	0.129	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
12	P12644	1.21e-30	124	408	0.110	0.127	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
13	P49001	2.37e-30	123	393	0.104	0.125	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
14	C8C060	2.39e-30	123	396	0.104	0.124	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
15	P12643	2.39e-30	123	396	0.104	0.124	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
16	Q90752	2.63e-30	124	405	0.104	0.121	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
17	A5HMF9	2.67e-30	123	404	0.104	0.121	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
18	A5HMF8	3.10e-30	123	404	0.104	0.121	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
19	P21274	3.14e-30	123	394	0.104	0.124	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
20	Q90751	3.53e-30	122	353	0.104	0.139	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04618 HD-ZIP_N	4.7e+02	12.7	HD-ZIP protein N terminus
2	PF00019 TGF_beta	1.3e-28	111.2	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282701

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340361	0.982	Activin receptor type-2B
2	9606.ENSP00000241416	0.852	Activin receptor type-2A
3	9606.ENSP00000377823	0.805	Protein NDRG4
4	9606.ENSP00000364979	0.761	Collagen alpha-1(IV) chain
5	9606.ENSP00000313809	0.726	Ameloblastin
6	9606.ENSP00000295550	0.680	Collagen alpha-3(VI) chain
7	9606.ENSP00000234091	0.676	DNA-binding protein inhibitor ID-2
8	9606.ENSP00000256759	0.647	Follistatin
9	9606.ENSP00000305714	0.636	Bone morphogenetic protein 1
10	9606.ENSP00000350359	0.632	Cyclic AMP-responsive element-binding protein 5
11	9606.ENSP00000204604	0.613	Chordin
12	9606.ENSP00000401907	0.610	Bone morphogenetic protein receptor type-1B
13	9606.ENSP00000363708	0.607	Bone morphogenetic protein receptor type-2
14	9606.ENSP00000341551	0.604	Mothers against decapentaplegic homolog 4
15	9606.ENSP00000361107	0.596	Bone morphogenetic protein receptor type-1A
16	9606.ENSP00000263640	0.587	Activin receptor type-1
17	9606.ENSP00000328181	0.573	Noggin
18	9606.ENSP00000173229	0.565	Netrin-1
19	9606.ENSP00000391249	0.564	Septin-9
20	9606.ENSP00000478319	0.558	Gremlin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.999	growth factor activity
GO:0033612	0.996	receptor serine/threonine kinase binding
GO:0070696	0.994	transmembrane receptor protein serine/threonine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0007275	0.988	multicellular organism development
GO:0009987	0.986	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0048731	0.925	system development
GO:0001501	0.921	skeletal system development
GO:0023052	0.919	signaling
GO:0007154	0.916	cell communication
GO:0050896	0.903	response to stimulus
GO:0019222	0.888	regulation of metabolic process
GO:0031325	0.873	positive regulation of cellular metabolic process
GO:0060255	0.863	regulation of macromolecule metabolic process
GO:0080090	0.835	regulation of primary metabolic process
GO:0051171	0.815	regulation of nitrogen compound metabolic process
GO:0010604	0.814	positive regulation of macromolecule metabolic process
GO:0051173	0.764	positive regulation of nitrogen compound metabolic process
GO:0051716	0.755	cellular response to stimulus
GO:0019219	0.716	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.694	regulation of biosynthetic process
GO:0007165	0.684	signal transduction
GO:0010556	0.683	regulation of macromolecule biosynthetic process
GO:0031326	0.583	regulation of cellular biosynthetic process
GO:0010468	0.571	regulation of gene expression
GO:0051252	0.567	regulation of RNA metabolic process
GO:0006355	0.552	regulation of DNA-templated transcription
GO:0045935	0.537	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.535	positive regulation of macromolecule biosynthetic process
GO:0031328	0.535	positive regulation of cellular biosynthetic process
GO:1903508	0.515	positive regulation of nucleic acid-templated transcription
GO:0045893	0.498	positive regulation of DNA-templated transcription
GO:0048513	0.496	animal organ development
GO:0048519	0.486	negative regulation of biological process
GO:0023051	0.471	regulation of signaling
GO:0010646	0.468	regulation of cell communication
GO:0070848	0.465	response to growth factor
GO:0048583	0.460	regulation of response to stimulus
GO:0007166	0.457	cell surface receptor signaling pathway
GO:0050793	0.456	regulation of developmental process
GO:0048523	0.401	negative regulation of cellular process
GO:0030154	0.397	cell differentiation
GO:0009653	0.387	anatomical structure morphogenesis
GO:0023056	0.375	positive regulation of signaling
GO:0009966	0.370	regulation of signal transduction
GO:0010647	0.365	positive regulation of cell communication
GO:0051239	0.364	regulation of multicellular organismal process
GO:0071363	0.364	cellular response to growth factor stimulus
GO:0051094	0.357	positive regulation of developmental process
GO:0007167	0.357	enzyme-linked receptor protein signaling pathway
GO:0006357	0.317	regulation of transcription by RNA polymerase II
GO:0007267	0.308	cell-cell signaling
GO:0048584	0.306	positive regulation of response to stimulus
GO:0045595	0.301	regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0031982	0.996	vesicle
GO:0071944	0.772	cell periphery
GO:0005622	0.720	intracellular anatomical structure
GO:0043231	0.663	intracellular membrane-bounded organelle
GO:1903561	0.586	extracellular vesicle
GO:0070062	0.562	extracellular exosome
GO:0005737	0.545	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]