StarFunc result for job id P12694

User Input

>input (445 residues)
MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDDKPQFPGASAE
FIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY
ESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYG
NISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGA
ASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDG
NDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHP
ISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQL
RKQQESLARHLQTYGEHYPLDHFDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12694	1.000	1.000	5.064E-81	445	1.000	1.000	P12694.pdb.gz	ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2
2	PDB:2bffA	0.880	0.999	2.653E-69	392	0.876	0.995	2bffA.pdb.gz	A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
3	PDB:1v1mA	0.835	0.998	3.782E-63	372	0.836	1.000	1v1mA.pdb.gz	Cross-Talk between Thiamin Diphosphate Binding and Phosphorylation Loop Conformation in Human Branched-Chain Alpha-Keto Acid Decarboxylase/Dehydrogenase.
4	AFDB:Q9LPL5	0.875	0.825	1.015E-48	472	0.436	0.411	Q9LPL5.pdb.gz	ODBA1_ARATH 2-oxoisovalerate dehydrogenase subunit alpha 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g21400 PE=2 SV=1
5	AFDB:Q54M22	0.858	0.866	1.254E-48	441	0.479	0.483	Q54M22.pdb.gz	ODBA_DICDI 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=bkdA PE=3 SV=1
6	AFDB:Q84JL2	0.885	0.835	7.516E-48	472	0.427	0.403	Q84JL2.pdb.gz	ODBA2_ARATH 2-oxoisovalerate dehydrogenase subunit alpha 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g09300 PE=1 SV=1
7	AFDB:Q38CH4	0.837	0.894	2.093E-42	416	0.393	0.421	Q38CH4.pdb.gz	Q38CH4_TRYB2 2-oxoisovalerate dehydrogenase subunit alpha OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7550 PE=3 SV=1
8	PDB:1umbA	0.772	0.944	1.801E-32	362	0.301	0.370	1umbA.pdb.gz	Ligand-induced Conformational Changes and a Reaction Intermediate in Branched-chain 2-Oxo Acid Dehydrogenase (E1) from Thermus thermophilus HB8, as Revealed by X-ray Crystallography
9	AFDB:Q5SLR4	0.775	0.937	3.340E-32	367	0.297	0.360	Q5SLR4.pdb.gz	ODBA_THET8 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA0229 PE=1 SV=1
10	AFDB:P21873	0.735	0.881	1.265E-30	369	0.256	0.309	P21873.pdb.gz	ODPA_GEOSE Pyruvate dehydrogenase E1 component subunit alpha OS=Geobacillus stearothermophilus OX=1422 GN=pdhA PE=1 SV=2
11	AFDB:F9UQ93	0.743	0.886	1.505E-29	370	0.256	0.308	F9UQ93.pdb.gz	F9UQ93_LACPL Pyruvate dehydrogenase E1 component subunit alpha OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=pdhA PE=4 SV=1
12	AFDB:P9WIS3	0.734	0.883	1.762E-29	367	0.301	0.365	P9WIS3.pdb.gz	BKDA_MYCTU 3-methyl-2-oxobutanoate dehydrogenase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=bkdA PE=1 SV=1
13	PDB:3dufA	0.728	0.880	1.191E-28	365	0.252	0.307	3dufA.pdb.gz	Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
14	PDB:1um9C	0.703	0.929	7.935E-28	335	0.274	0.364	1um9C.pdb.gz
15	AFDB:P47516	0.745	0.921	2.018E-27	358	0.222	0.277	P47516.pdb.gz	ODPA_MYCGE Pyruvate dehydrogenase E1 component subunit alpha OS=Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37) OX=243273 GN=pdhA PE=3 SV=1
16	PDB:3dv0E	0.693	0.887	2.852E-26	344	0.229	0.297	3dv0E.pdb.gz	Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
17	PDB:3exeA	0.686	0.836	2.875E-22	363	0.196	0.240	3exeA.pdb.gz	Structural basis for inactivation of the human pyruvate dehydrogenase complex by phosphorylation: role of disordered phosphorylation loops.
18	PDB:6cerA	0.615	0.790	1.106E-19	342	0.191	0.249	6cerA.pdb.gz	Pyruvate dehydrogenase complex deficiency is linked to regulatory loop disorder in the alpha V138M variant of human pyruvate dehydrogenase.
19	PDB:6u3jA	0.555	0.297	1.713E-11	876	0.112	0.057	6u3jA.pdb.gz	Inhibition and Crystal Structure of the Human DHTKD1-Thiamin Diphosphate Complex.
20	PDB:1ay0A	0.397	0.274	3.949E-8	678	0.157	0.103	1ay0A.pdb.gz	Identification of catalytically important residues in yeast transketolase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11960	0.0	847	441	0.928	0.937	ODBA_RAT 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) OS=Rattus norvegicus OX=10116 GN=Bckdha PE=1 SV=1
2	P12694	0.0	932	445	1.000	1.000	ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2
3	P50136	0.0	838	442	0.915	0.921	ODBA_MOUSE 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Bckdha PE=1 SV=1
4	Q54M22	7.38e-157	452	441	0.483	0.488	ODBA_DICDI 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=bkdA PE=3 SV=1
5	Q84JL2	1.58e-140	412	472	0.422	0.398	ODBA2_ARATH 2-oxoisovalerate dehydrogenase subunit alpha 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g09300 PE=1 SV=1
6	Q9LPL5	1.39e-137	405	472	0.425	0.400	ODBA1_ARATH 2-oxoisovalerate dehydrogenase subunit alpha 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g21400 PE=2 SV=1
7	Q38CH4	1.39e-112	339	416	0.387	0.413	Q38CH4_TRYB2 2-oxoisovalerate dehydrogenase subunit alpha OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7550 PE=3 SV=1
8	P9WIS3	4.24e-66	218	367	0.312	0.379	BKDA_MYCTU 3-methyl-2-oxobutanoate dehydrogenase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=bkdA PE=1 SV=1
9	F4KIN4	4.46e-66	218	365	0.220	0.268	PANE_ARATH Putative 2-dehydropantoate 2-reductase OS=Arabidopsis thaliana OX=3702 GN=KPR PE=3 SV=1
10	Q5SLR4	1.60e-65	216	367	0.290	0.351	ODBA_THET8 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA0229 PE=1 SV=1
11	F9UQ93	3.51e-58	197	370	0.258	0.311	F9UQ93_LACPL Pyruvate dehydrogenase E1 component subunit alpha OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=pdhA PE=4 SV=1
12	P21873	1.57e-56	192	369	0.272	0.328	ODPA_GEOSE Pyruvate dehydrogenase E1 component subunit alpha OS=Geobacillus stearothermophilus OX=1422 GN=pdhA PE=1 SV=2
13	P47516	2.06e-44	160	358	0.229	0.285	ODPA_MYCGE Pyruvate dehydrogenase E1 component subunit alpha OS=Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37) OX=243273 GN=pdhA PE=3 SV=1
14	P75390	2.26e-40	149	358	0.220	0.274	ODPA_MYCPN Pyruvate dehydrogenase E1 component subunit alpha OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=pdhA PE=1 SV=1
15	P52901	3.39e-40	150	389	0.218	0.249	ODPA1_ARATH Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=E1 ALPHA PE=1 SV=2
16	P16387	6.02e-38	144	420	0.209	0.221	ODPA_YEAST Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDA1 PE=1 SV=2
17	Q9ZQY0	3.07e-37	142	392	0.213	0.242	Q9ZQY0_MAIZE Pyruvate dehydrogenase E1 component subunit alpha OS=Zea mays OX=4577 PE=4 SV=1
18	Q8H1Y0	9.67e-37	140	393	0.216	0.244	ODPA2_ARATH Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IAR4 PE=1 SV=2
19	Q54C70	5.79e-36	138	377	0.211	0.249	ODPA_DICDI Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=pdhA PE=1 SV=1
20	P52899	1.67e-35	137	397	0.222	0.249	ODPA_CAEEL Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=T05H10.6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13292 DXP_synthase_N	3.6	18.3	1-deoxy-D-xylulose-5-phosphate synthase
2	PF00676 E1_dh	7.1e-112	384.8	Dehydrogenase E1 component
3	PF02775 TPP_enzyme_C	1.2	20.3	Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269980

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318351	0.999	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
2	9606.ENSP00000477341	0.996	Protein phosphatase 1K, mitochondrial
3	9606.ENSP00000359151	0.995	Dihydrolipoamide branched chain transacylase E2
4	9606.ENSP00000205402	0.993	Dihydrolipoyl dehydrogenase, mitochondrial
5	9606.ENSP00000307241	0.989	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
6	9606.ENSP00000322991	0.981	Branched-chain-amino-acid aminotransferase, mitochondrial
7	9606.ENSP00000365462	0.977	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
8	9606.ENSP00000378405	0.974	[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial
9	9606.ENSP00000419027	0.970	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
10	9606.ENSP00000418397	0.969	Isovaleryl-CoA dehydrogenase, mitochondrial
11	9606.ENSP00000443459	0.967	Branched-chain-amino-acid aminotransferase, cytosolic
12	9606.ENSP00000357873	0.942	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
13	9606.ENSP00000319531	0.926	Glycine cleavage system H protein, mitochondrial
14	9606.ENSP00000377115	0.926	Lipoyltransferase 1, mitochondrial
15	9606.ENSP00000281182	0.919	Isobutyryl-CoA dehydrogenase, mitochondrial
16	9606.ENSP00000257549	0.910	L-serine dehydratase/L-threonine deaminase
17	9606.ENSP00000472474	0.910	L-amino-acid oxidase
18	9606.ENSP00000385790	0.909	Serine dehydratase-like
19	9606.ENSP00000335304	0.903	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
20	9606.ENSP00000227868	0.869	Pyruvate dehydrogenase protein X component, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016624	1.000	oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0016830	0.991	carbon-carbon lyase activity
GO:0016831	0.976	carboxy-lyase activity
GO:0003863	0.671	3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0019752	0.995	carboxylic acid metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0009083	0.974	branched-chain amino acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.996	intracellular organelle lumen
GO:0032991	0.988	protein-containing complex
GO:0005759	0.923	mitochondrial matrix
GO:1902494	0.894	catalytic complex
GO:0098798	0.840	mitochondrial protein-containing complex
GO:1990204	0.784	oxidoreductase complex
GO:0045239	0.597	tricarboxylic acid cycle enzyme complex
GO:0045240	0.462	dihydrolipoyl dehydrogenase complex
GO:0030062	0.433	mitochondrial tricarboxylic acid cycle enzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.4.-	1.000	With a disulfide as acceptor.
EC:4.1.-.-	0.991	Carbon-carbon lyases.
EC:4.1.1.-	0.976	Carboxy-lyases.
RHEA:13457	0.671	(R)-N(6)-lipoyl-L-lysyl-[dihydrolipoyllysine-residue (2-methylpropanoyl)transferase] + 3-methyl-2-oxobutanoate + H(+) = (R)-N(6)-(S(8)-2-methylpropanoyldihydrolipoyl)-L-lysyl-[dihydrolipoyllysine-residue (2-methylpropanoyl)transferase] + CO2
EC:1.2.4.4	0.671	3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).

[back to server]