StarFunc result for job id P12724

User Input

>input (160 residues)
MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNY
RWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNI
SNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12724	1.000	1.000	2.775E-35	160	1.000	1.000	P12724.pdb.gz	ECP_HUMAN Eosinophil cationic protein OS=Homo sapiens OX=9606 GN=RNASE3 PE=1 SV=2
2	PDB:1h1hA	0.820	0.977	3.939E-27	134	0.825	0.985	1h1hA.pdb.gz	The Crystal Structure of Eosinophil Cationic Protein in Complex with 2'5'-Adp at 2.0 A Resolution Reveals the Details of the Ribonucleolytic Active Site
3	AFDB:O18937	0.895	0.906	9.281E-26	158	0.719	0.728	O18937.pdb.gz	RNAS2_AOTTR Non-secretory ribonuclease OS=Aotus trivirgatus OX=9505 GN=RNASE2 PE=1 SV=1
4	AFDB:P10153	0.828	0.823	2.369E-25	161	0.694	0.689	P10153.pdb.gz	RNAS2_HUMAN Non-secretory ribonuclease OS=Homo sapiens OX=9606 GN=RNASE2 PE=1 SV=2
5	AFDB:P47783	0.891	0.891	4.711E-25	160	0.675	0.675	P47783.pdb.gz	RNAS2_MACFA Non-secretory ribonuclease OS=Macaca fascicularis OX=9541 GN=RNASE2 PE=1 SV=1
6	AFDB:P47786	0.833	0.844	1.363E-24	158	0.688	0.696	P47786.pdb.gz	RNAS2_SAGOE Non-secretory ribonuclease OS=Saguinus oedipus OX=9490 GN=RNASE2 PE=3 SV=1
7	PDB:1hi2A	0.807	0.953	3.242E-21	135	0.544	0.644	1hi2A.pdb.gz	Mapping the Ribonucleolytic Active Site of Eosinophil-Derived Neurotoxin (Edn): High Resolution Crystal Structures of Edn Complexes with Adenylic Nucleotide Inhibitors
8	AFDB:P97425	0.775	0.795	1.111E-19	156	0.469	0.481	P97425.pdb.gz	ECP2_MOUSE Eosinophil cationic protein 2 OS=Mus musculus OX=10090 GN=Ear2 PE=2 SV=1
9	AFDB:Q923L7	0.776	0.801	3.877E-19	155	0.469	0.484	Q923L7.pdb.gz	Q923L7_MOUSE Ear6 protein OS=Mus musculus OX=10090 GN=Ear6 PE=1 SV=1
10	AFDB:Q9H1E1	0.814	0.834	2.714E-17	156	0.369	0.378	Q9H1E1.pdb.gz	RNAS7_HUMAN Ribonuclease 7 OS=Homo sapiens OX=9606 GN=RNASE7 PE=1 SV=2
11	AFDB:Q93091	0.813	0.864	4.204E-17	150	0.406	0.433	Q93091.pdb.gz	RNAS6_HUMAN Ribonuclease K6 OS=Homo sapiens OX=9606 GN=RNASE6 PE=1 SV=2
12	AFDB:Q9D244	0.782	0.816	4.807E-16	153	0.356	0.373	Q9D244.pdb.gz	RNAS6_MOUSE Ribonuclease K6 OS=Mus musculus OX=10090 GN=Rnase6 PE=1 SV=2
13	PDB:6enpA	0.728	0.901	9.908E-15	128	0.350	0.438	6enpA.pdb.gz
14	PDB:2hkyA	0.697	0.848	1.903E-11	129	0.312	0.388	2hkyA.pdb.gz
15	PDB:1rraA	0.659	0.839	6.699E-10	124	0.225	0.290	1rraA.pdb.gz
16	PDB:3tsrA	0.653	0.830	7.591E-10	124	0.244	0.315	3tsrA.pdb.gz
17	PDB:1kh8A	0.619	0.777	1.710E-9	125	0.219	0.280	1kh8A.pdb.gz	The crystal structure of the cis-proline to glycine variant (P114G) of ribonuclease A.
18	PDB:2e0jA	0.661	0.815	5.266E-9	128	0.256	0.320	2e0jA.pdb.gz
19	PDB:1gv7A	0.594	0.754	1.047E-8	123	0.219	0.285	1gv7A.pdb.gz
20	PDB:2rnfA	0.628	0.823	3.888E-8	120	0.212	0.283	2rnfA.pdb.gz	The three-dimensional structure of human RNase 4, unliganded and complexed with d(Up), reveals the basis for its uridine selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12724	2.65e-117	330	160	1.000	1.000	ECP_HUMAN Eosinophil cationic protein OS=Homo sapiens OX=9606 GN=RNASE3 PE=1 SV=2
2	P47786	1.90e-75	224	158	0.688	0.696	RNAS2_SAGOE Non-secretory ribonuclease OS=Saguinus oedipus OX=9490 GN=RNASE2 PE=3 SV=1
3	O18937	9.03e-72	214	158	0.719	0.728	RNAS2_AOTTR Non-secretory ribonuclease OS=Aotus trivirgatus OX=9505 GN=RNASE2 PE=1 SV=1
4	P47784	7.39e-71	212	161	0.694	0.689	RNAS2_PONPY Non-secretory ribonuclease OS=Pongo pygmaeus OX=9600 GN=RNASE2 PE=1 SV=1
5	P10153	7.81e-71	212	161	0.694	0.689	RNAS2_HUMAN Non-secretory ribonuclease OS=Homo sapiens OX=9606 GN=RNASE2 PE=1 SV=2
6	P47783	1.98e-67	204	160	0.675	0.675	RNAS2_MACFA Non-secretory ribonuclease OS=Macaca fascicularis OX=9541 GN=RNASE2 PE=1 SV=1
7	Q923L6	1.25e-34	120	156	0.481	0.494	Q923L6_MOUSE Eosinophil-associated ribonuclease 10 OS=Mus musculus OX=10090 GN=Ear10 PE=3 SV=1
8	Q9R126	5.64e-33	116	155	0.394	0.406	Q9R126_MOUSE Eosinophil-associated ribonuclease 7 (Fragment) OS=Mus musculus OX=10090 GN=Ear7 PE=3 SV=1
9	P97426	9.24e-31	110	155	0.406	0.419	ECP1_MOUSE Eosinophil cationic protein 1 OS=Mus musculus OX=10090 GN=Ear1 PE=2 SV=1
10	Q923L7	1.20e-30	110	155	0.381	0.394	Q923L7_MOUSE Ear6 protein OS=Mus musculus OX=10090 GN=Ear6 PE=1 SV=1
11	P97425	1.47e-30	110	156	0.388	0.397	ECP2_MOUSE Eosinophil cationic protein 2 OS=Mus musculus OX=10090 GN=Ear2 PE=2 SV=1
12	Q93091	9.83e-28	102	150	0.369	0.393	RNAS6_HUMAN Ribonuclease K6 OS=Homo sapiens OX=9606 GN=RNASE6 PE=1 SV=2
13	Q9D244	8.75e-25	95.1	153	0.331	0.346	RNAS6_MOUSE Ribonuclease K6 OS=Mus musculus OX=10090 GN=Rnase6 PE=1 SV=2
14	Q9H1E1	1.87e-24	94.4	156	0.325	0.333	RNAS7_HUMAN Ribonuclease 7 OS=Homo sapiens OX=9606 GN=RNASE7 PE=1 SV=2
15	Q8TDE3	5.28e-23	90.9	154	0.325	0.338	RNAS8_HUMAN Ribonuclease 8 OS=Homo sapiens OX=9606 GN=RNASE8 PE=1 SV=1
16	P07998	1.90e-10	58.2	156	0.250	0.256	RNAS1_HUMAN Ribonuclease pancreatic OS=Homo sapiens OX=9606 GN=RNASE1 PE=1 SV=4
17	P00684	2.82e-10	57.4	152	0.225	0.237	RNS1B_RAT Ribonuclease pancreatic beta-type OS=Rattus norvegicus OX=10116 GN=Rnase1 PE=1 SV=1
18	P61823	3.74e-09	54.3	150	0.231	0.247	RNAS1_BOVIN Ribonuclease pancreatic OS=Bos taurus OX=9913 GN=RNASE1 PE=1 SV=1
19	P00683	5.68e-09	53.9	149	0.244	0.262	RNAS1_MOUSE Ribonuclease pancreatic OS=Mus musculus OX=10090 GN=Rnase1 PE=1 SV=2
20	P00669	5.55e-08	51.2	150	0.188	0.200	RNS_BOVIN Seminal ribonuclease OS=Bos taurus OX=9913 GN=SRN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00074 RnaseA	9e-31	118.2	Pancreatic ribonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302324

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303276	0.955	Non-secretory ribonuclease
2	9606.ENSP00000225371	0.905	Eosinophil peroxidase
3	9606.ENSP00000225275	0.867	Myeloperoxidase
4	9606.ENSP00000466090	0.812	Neutrophil elastase
5	9606.ENSP00000336762	0.787	Angiogenin
6	9606.ENSP00000231454	0.770	Interleukin-5
7	9606.ENSP00000312134	0.738	Bone marrow proteoglycan
8	9606.ENSP00000297435	0.728	Neutrophil defensin 4
9	9606.ENSP00000302234	0.715	Eotaxin
10	9606.ENSP00000237380	0.699	Mediator of RNA polymerase II transcription subunit 28
11	9606.ENSP00000216336	0.691	Cathepsin G
12	9606.ENSP00000221804	0.682	Galectin-10
13	9606.ENSP00000231449	0.642	Interleukin-4
14	9606.ENSP00000306512	0.623	Interleukin-8
15	9606.ENSP00000304915	0.605	Interleukin-13
16	9606.ENSP00000233997	0.580	Azurocidin
17	9606.ENSP00000357097	0.579	High affinity immunoglobulin epsilon receptor subunit alpha
18	9606.ENSP00000441600	0.570	C-C chemokine receptor type 3
19	9606.ENSP00000474412	0.567	C-C motif chemokine 5
20	9606.ENSP00000296871	0.566	Granulocyte-macrophage colony-stimulating factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004540	1.000	ribonuclease activity
GO:0005515	0.917	protein binding
GO:0008289	0.907	lipid binding
GO:0097367	0.895	carbohydrate derivative binding
GO:0001530	0.593	lipopolysaccharide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.990	cellular process
GO:0009605	0.989	response to external stimulus
GO:0006952	0.985	defense response
GO:0044419	0.966	biological process involved in interspecies interaction between organisms
GO:0051707	0.960	response to other organism
GO:0071704	0.958	organic substance metabolic process
GO:0098542	0.946	defense response to other organism
GO:0044237	0.895	cellular metabolic process
GO:0043170	0.820	macromolecule metabolic process
GO:0044238	0.819	primary metabolic process
GO:0006807	0.806	nitrogen compound metabolic process
GO:0002376	0.746	immune system process
GO:0019730	0.512	antimicrobial humoral response
GO:0006725	0.444	cellular aromatic compound metabolic process
GO:1901360	0.423	organic cyclic compound metabolic process
GO:0042221	0.417	response to chemical
GO:0034641	0.378	cellular nitrogen compound metabolic process
GO:0009617	0.368	response to bacterium
GO:0061844	0.363	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0042742	0.336	defense response to bacterium
GO:0009615	0.330	response to virus
GO:0006139	0.317	nucleobase-containing compound metabolic process
GO:0016070	0.314	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0030141	0.996	secretory granule
GO:0070013	0.995	intracellular organelle lumen
GO:0005615	0.994	extracellular space
GO:0060205	0.985	cytoplasmic vesicle lumen
GO:0042582	0.982	azurophil granule
GO:0034774	0.979	secretory granule lumen
GO:0005775	0.925	vacuolar lumen
GO:0035578	0.896	azurophil granule lumen
GO:0070062	0.407	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]