StarFunc result for job id P12755

User Input

>input (728 residues)
MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAV
PAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKR
LCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKT
DAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSP
SAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARL
GRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWLRTLA
GSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVA
LAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDS
EAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEA
ELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKE
KLREATEAKRNLRKEIERLRAENEKKMKEANESRLRLKRELEQARQARVCDKGCEAGRLR
AKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEKVVKELQEQLWPRARPEAAGS
EGAAELEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12755	1.000	1.000	0.000	728	1.000	1.000	P12755.pdb.gz	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
2	AFDB:E1BSJ7	0.328	0.319	1.932E-80	750	0.806	0.783	E1BSJ7.pdb.gz	E1BSJ7_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=3 SV=2
3	AFDB:B0S7D7	0.354	0.355	4.602E-76	727	0.701	0.702	B0S7D7.pdb.gz
4	AFDB:F1P0N0	0.304	0.319	9.694E-41	690	0.341	0.359	F1P0N0.pdb.gz	F1P0N0_CHICK SKI like proto-onco OS=Gallus gallus OX=9031 GN=SKIL PE=3 SV=2
5	AFDB:Q00G33	0.269	0.209	8.085E-25	958	0.264	0.200	Q00G33.pdb.gz	Q00G33_DROME SnoN2 OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
6	AFDB:B8A5S6	0.068	0.072	1.503E-2	681	0.124	0.132	B8A5S6.pdb.gz	B8A5S6_DANRE Angiomotin like 2b isoform X1 OS=Danio rerio OX=7955 GN=zgc:154007 PE=3 SV=1
7	AFDB:Q9UPV0	0.112	0.061	1.503E-2	1460	0.132	0.066	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
8	AFDB:B8A6E8	0.071	0.070	1.594E-2	741	0.141	0.139	B8A6E8.pdb.gz	B8A6E8_DANRE Leucine zipper putative tumor suppressor 2 homolog OS=Danio rerio OX=7955 GN=lzts2 PE=1 SV=1
9	AFDB:E2JKZ0	0.078	0.046	1.691E-2	1351	0.135	0.073	E2JKZ0.pdb.gz	E2JKZ0_CAEEL Dynactin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dnc-1 PE=1 SV=1
10	AFDB:O15049	0.084	0.110	2.709E-2	544	0.124	0.165	O15049.pdb.gz	N4BP3_HUMAN NEDD4-binding protein 3 OS=Homo sapiens OX=9606 GN=N4BP3 PE=1 SV=3
11	PDB:7apkO	0.074	0.300	2.494	155	0.045	0.213	7apkO.pdb.gz
12	PDB:5u6yA	0.065	0.082	2.977	459	0.059	0.094	5u6yA.pdb.gz
13	PDB:8at3A	0.112	0.247	3.553	286	0.049	0.126	8at3A.pdb.gz
14	PDB:7zu0A	0.042	0.034	4.497	954	0.025	0.019	7zu0A.pdb.gz
15	PDB:7edxT	0.029	0.151	5.693	113	0.004	0.027	7edxT.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:2lqnA	0.058	0.111	6.038	303	0.032	0.076	2lqnA.pdb.gz
17	PDB:7myjC	0.047	0.064	6.038	465	0.015	0.024	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
18	PDB:7o4iW	0.068	0.133	6.405	312	0.044	0.103	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:2qxlB	0.042	0.047	6.794	625	0.029	0.034	2qxlB.pdb.gz	Insights into hsp70 chaperone activity from a crystal structure of the yeast hsp110 Sse1.
20	PDB:3pvuA	0.030	0.036	7.644	609	0.004	0.005	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K628	0.0	1284	727	0.938	0.939	A0A0G2K628_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=1 SV=2
2	A0A8I5ZYW7	0.0	1192	686	0.886	0.940	A0A8I5ZYW7_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=3 SV=1
3	E1BSJ7	0.0	1071	750	0.804	0.780	E1BSJ7_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=3 SV=2
4	P12755	0.0	1470	728	1.000	1.000	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
5	P17863	0.0	655	437	0.468	0.780	SKI_AVIES Transforming protein Ski OS=Avian erythroblastosis virus (strain Sloan-Kettering) OX=11862 GN=V-SKI PE=1 SV=1
6	P49140	0.0	1071	750	0.804	0.780	SKI_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=1 SV=1
7	Q1ECW8	0.0	902	727	0.695	0.696	Q1ECW8_DANRE Ski oncogene OS=Danio rerio OX=7955 GN=id:ibd1250 PE=2 SV=1
8	Q60698	0.0	1269	725	0.922	0.926	SKI_MOUSE Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 SV=2
9	Q9YI02	0.0	778	695	0.584	0.612	Q9YI02_DANRE Ski oncogene OS=Danio rerio OX=7955 GN=skiB PE=2 SV=1
10	D3ZWL1	9.77e-147	446	677	0.383	0.412	D3ZWL1_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
11	Q60665	3.43e-145	442	675	0.379	0.409	SKIL_MOUSE Ski-like protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=2
12	Q60979	3.31e-142	434	674	0.375	0.405	Q60979_MOUSE SnoN protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=1
13	F1P0N0	1.82e-141	432	690	0.376	0.397	F1P0N0_CHICK SKI like proto-onco OS=Gallus gallus OX=9031 GN=SKIL PE=3 SV=2
14	Q05951	4.03e-141	432	690	0.376	0.397	Q05951_CHICK C-sno protein OS=Gallus gallus OX=9031 GN=c-sno PE=2 SV=1
15	P12757	9.97e-141	431	684	0.371	0.395	SKIL_HUMAN Ski-like protein OS=Homo sapiens OX=9606 GN=SKIL PE=1 SV=2
16	A0A8I6A1B8	1.74e-96	311	551	0.224	0.296	A0A8I6A1B8_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
17	Q00G33	7.79e-62	226	958	0.163	0.124	Q00G33_DROME SnoN2 OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
18	Q00G30	1.87e-61	226	1223	0.163	0.097	Q00G30_DROME Sno oncogene, isoform B OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
19	A0PDV0	3.78e-61	210	331	0.155	0.341	A0PDV0_DROME DSki protein short isoform OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
20	A0PDV1	1.18e-58	217	1011	0.161	0.116	A0PDV1_DROME DSki protein long isoform (Fragment) OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08782 c-SKI_SMAD_bind	6.6e-36	133.7	c-SKI Smad4 binding domain
2	PF02437 Ski_Sno	7.3e-44	159.3	SKI/SNO/DAC family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341551	0.999	Mothers against decapentaplegic homolog 4
2	9606.ENSP00000262160	0.996	Mothers against decapentaplegic homolog 2
3	9606.ENSP00000332973	0.995	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000268712	0.991	Nuclear receptor corepressor 1
5	9606.ENSP00000378402	0.986	Paired amphipathic helix protein Sin3a
6	9606.ENSP00000415243	0.985	Ski-like protein
7	9606.ENSP00000426568	0.980	Mothers against decapentaplegic homolog 1
8	9606.ENSP00000441954	0.959	Mothers against decapentaplegic homolog 5
9	9606.ENSP00000339992	0.941	Transcriptional activator Myb
10	9606.ENSP00000362649	0.937	Histone deacetylase 1
11	9606.ENSP00000253024	0.925	Transcription intermediary factor 1-beta
12	9606.ENSP00000369131	0.924	Paired amphipathic helix protein Sin3b
13	9606.ENSP00000430432	0.915	Histone deacetylase 2
14	9606.ENSP00000453872	0.904	E3 ubiquitin-protein ligase Arkadia
15	9606.ENSP00000296504	0.900	Histone deacetylase complex subunit SAP30
16	9606.ENSP00000362592	0.900	Histone-binding protein RBBP4
17	9606.ENSP00000369424	0.900	Histone-binding protein RBBP7
18	9606.ENSP00000481842	0.900	Histone deacetylase complex subunit SAP18
19	9606.ENSP00000302967	0.851	Histone deacetylase 3
20	9606.ENSP00000262435	0.830	E3 ubiquitin-protein ligase SMURF2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	0.999	DNA-binding transcription factor binding
GO:0042802	0.998	identical protein binding
GO:0019904	0.996	protein domain specific binding
GO:0140110	0.991	transcription regulator activity
GO:0019899	0.966	enzyme binding
GO:0046332	0.899	SMAD binding
GO:0043167	0.888	ion binding
GO:1901363	0.858	heterocyclic compound binding
GO:0097159	0.858	organic cyclic compound binding
GO:0000981	0.858	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	0.842	DNA binding
GO:0046872	0.836	metal ion binding
GO:0043565	0.834	sequence-specific DNA binding
GO:0031625	0.817	ubiquitin protein ligase binding
GO:0001217	0.772	DNA-binding transcription repressor activity
GO:0019900	0.756	kinase binding
GO:0019901	0.750	protein kinase binding
GO:0001227	0.748	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0008270	0.741	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.989	regulation of biological process
GO:0032502	0.971	developmental process
GO:0032501	0.965	multicellular organismal process
GO:0048513	0.934	animal organ development
GO:0050794	0.924	regulation of cellular process
GO:0019222	0.909	regulation of metabolic process
GO:0080090	0.902	regulation of primary metabolic process
GO:0060255	0.901	regulation of macromolecule metabolic process
GO:0051171	0.901	regulation of nitrogen compound metabolic process
GO:0048519	0.895	negative regulation of biological process
GO:0048523	0.891	negative regulation of cellular process
GO:0010556	0.888	regulation of macromolecule biosynthetic process
GO:0031326	0.888	regulation of cellular biosynthetic process
GO:0019219	0.887	regulation of nucleobase-containing compound metabolic process
GO:0009888	0.884	tissue development
GO:0010468	0.883	regulation of gene expression
GO:0051252	0.878	regulation of RNA metabolic process
GO:0010605	0.859	negative regulation of macromolecule metabolic process
GO:2001141	0.856	regulation of RNA biosynthetic process
GO:0048583	0.854	regulation of response to stimulus
GO:0006355	0.853	regulation of DNA-templated transcription
GO:0048731	0.852	system development
GO:0051172	0.848	negative regulation of nitrogen compound metabolic process
GO:0050896	0.847	response to stimulus
GO:0031324	0.829	negative regulation of cellular metabolic process
GO:0045934	0.790	negative regulation of nucleobase-containing compound metabolic process
GO:0051716	0.783	cellular response to stimulus
GO:0048518	0.777	positive regulation of biological process
GO:0051253	0.777	negative regulation of RNA metabolic process
GO:0009966	0.772	regulation of signal transduction
GO:0006357	0.741	regulation of transcription by RNA polymerase II
GO:0010558	0.725	negative regulation of macromolecule biosynthetic process
GO:1902679	0.715	negative regulation of RNA biosynthetic process
GO:0045892	0.714	negative regulation of DNA-templated transcription
GO:0048522	0.710	positive regulation of cellular process
GO:0007165	0.681	signal transduction
GO:0000122	0.624	negative regulation of transcription by RNA polymerase II
GO:0007166	0.598	cell surface receptor signaling pathway
GO:0060537	0.591	muscle tissue development
GO:0008283	0.590	cell population proliferation
GO:0090092	0.560	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009968	0.519	negative regulation of signal transduction
GO:0008152	0.494	metabolic process
GO:0007178	0.484	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071704	0.452	organic substance metabolic process
GO:0017015	0.401	regulation of transforming growth factor beta receptor signaling pathway
GO:0051173	0.397	positive regulation of nitrogen compound metabolic process
GO:0010604	0.397	positive regulation of macromolecule metabolic process
GO:0007507	0.391	heart development
GO:0006807	0.359	nitrogen compound metabolic process
GO:0044238	0.358	primary metabolic process
GO:0043170	0.353	macromolecule metabolic process
GO:0031325	0.352	positive regulation of cellular metabolic process
GO:0051239	0.349	regulation of multicellular organismal process
GO:0065009	0.322	regulation of molecular function
GO:0042127	0.319	regulation of cell population proliferation
GO:0009653	0.307	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.996	nucleoplasm
GO:0005737	0.976	cytoplasm
GO:0043228	0.967	non-membrane-bounded organelle
GO:0005829	0.941	cytosol
GO:0005667	0.940	transcription regulator complex
GO:0043232	0.931	intracellular non-membrane-bounded organelle
GO:0140513	0.615	nuclear protein-containing complex
GO:0005856	0.422	cytoskeleton
GO:0016604	0.376	nuclear body
GO:0005694	0.352	chromosome
GO:0000785	0.338	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]