StarFunc result for job id P12757

User Input

>input (684 residues)
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEA
PVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARHSQESMSPTV
FLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFP
QNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAP
QTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVS
QSKELTKTEASKSISRQSEKAHSSGKLQKTVSYPDVSLEEQEKMDLKTSRELCSRLDASI
SNNSTSKRKSESATCNLVRDINKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMRTYLK
QQEKLNLILQKKQQLQMEVKMLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQ
KDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLAELRQRLDHAEADRQELQDELRQEREA
RQKLEMMIKELKLQILKSSKTAKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12757	1.000	1.000	0.000	684	1.000	1.000	P12757.pdb.gz	SKIL_HUMAN Ski-like protein OS=Homo sapiens OX=9606 GN=SKIL PE=1 SV=2
2	AFDB:D3ZWL1	0.559	0.564	1.764E-93	677	0.887	0.897	D3ZWL1.pdb.gz	D3ZWL1_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
3	AFDB:F1P0N0	0.410	0.407	5.871E-80	690	0.746	0.739	F1P0N0.pdb.gz	F1P0N0_CHICK SKI like proto-onco OS=Gallus gallus OX=9031 GN=SKIL PE=3 SV=2
4	AFDB:Q9YI02	0.321	0.316	3.533E-46	695	0.368	0.363	Q9YI02.pdb.gz	Q9YI02_DANRE Ski oncogene OS=Danio rerio OX=7955 GN=skiB PE=2 SV=1
5	AFDB:B0S7D7	0.308	0.290	4.498E-46	727	0.382	0.359	B0S7D7.pdb.gz
6	AFDB:E1BSJ7	0.322	0.295	1.582E-44	750	0.386	0.352	E1BSJ7.pdb.gz	E1BSJ7_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=3 SV=2
7	AFDB:P12755	0.345	0.326	8.569E-44	728	0.364	0.342	P12755.pdb.gz	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
8	AFDB:Q00G33	0.294	0.213	1.782E-25	958	0.251	0.180	Q00G33.pdb.gz	Q00G33_DROME SnoN2 OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
9	AFDB:Q00G30	0.288	0.165	9.679E-19	1223	0.202	0.113	Q00G30.pdb.gz	Q00G30_DROME Sno oncogene, isoform B OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
10	AFDB:Q9UI36	0.139	0.127	1.354E-9	758	0.174	0.157	Q9UI36.pdb.gz	DACH1_HUMAN Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1 PE=1 SV=4
11	PDB:6lthM	0.090	0.224	1.102	259	0.026	0.069	6lthM.pdb.gz	Structure of nucleosome-bound human BAF complex.
12	PDB:7o4iW	0.068	0.131	1.583	312	0.039	0.087	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:1wv4A	0.040	0.127	1.681	162	0.018	0.074	1wv4A.pdb.gz	Structure of Escherichia coli pyridoxine 5'-phosphate oxidase in a tetragonal crystal form: insights into the mechanistic pathway of the enzyme.
14	PDB:4or8B	0.037	0.069	1.897	226	0.037	0.111	4or8B.pdb.gz
15	PDB:1z9cC	0.048	0.142	2.015	138	0.035	0.174	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
16	PDB:3mkaM	0.037	0.085	2.894	224	0.015	0.045	3mkaM.pdb.gz
17	PDB:7f5sLT	0.068	0.240	2.894	159	0.026	0.113	7f5sLT.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
18	PDB:7btbX	0.055	0.173	3.074	141	0.038	0.184	7btbX.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
19	PDB:6fyxp	0.046	0.048	4.157	647	0.019	0.020	6fyxp.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
20	PDB:7zu0A	0.042	0.033	4.415	954	0.022	0.016	7zu0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A1B8	0.0	924	551	0.675	0.838	A0A8I6A1B8_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
2	D3ZWL1	0.0	1256	677	0.889	0.898	D3ZWL1_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
3	F1P0N0	0.0	1041	690	0.753	0.746	F1P0N0_CHICK SKI like proto-onco OS=Gallus gallus OX=9031 GN=SKIL PE=3 SV=2
4	P12757	0.0	1413	684	1.000	1.000	SKIL_HUMAN Ski-like protein OS=Homo sapiens OX=9606 GN=SKIL PE=1 SV=2
5	Q05951	0.0	1039	690	0.753	0.746	Q05951_CHICK C-sno protein OS=Gallus gallus OX=9031 GN=c-sno PE=2 SV=1
6	Q60665	0.0	1233	675	0.880	0.892	SKIL_MOUSE Ski-like protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=2
7	Q60979	0.0	1209	674	0.868	0.881	Q60979_MOUSE SnoN protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=1
8	Q9YI02	3.53e-136	417	695	0.382	0.376	Q9YI02_DANRE Ski oncogene OS=Danio rerio OX=7955 GN=skiB PE=2 SV=1
9	P12755	1.32e-127	396	728	0.389	0.365	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
10	Q60698	1.34e-110	352	725	0.363	0.342	SKI_MOUSE Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 SV=2
11	E1BSJ7	2.51e-107	344	750	0.251	0.229	E1BSJ7_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=3 SV=2
12	P49140	2.70e-107	344	750	0.251	0.229	SKI_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=1 SV=1
13	A0A8I5ZYW7	7.52e-107	341	686	0.269	0.268	A0A8I5ZYW7_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=3 SV=1
14	P17863	8.23e-105	328	437	0.244	0.382	SKI_AVIES Transforming protein Ski OS=Avian erythroblastosis virus (strain Sloan-Kettering) OX=11862 GN=V-SKI PE=1 SV=1
15	A0A0G2K628	1.21e-102	331	727	0.243	0.228	A0A0G2K628_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=1 SV=2
16	Q1ECW8	2.11e-101	328	727	0.262	0.246	Q1ECW8_DANRE Ski oncogene OS=Danio rerio OX=7955 GN=id:ibd1250 PE=2 SV=1
17	A0PDV0	3.72e-62	212	331	0.164	0.338	A0PDV0_DROME DSki protein short isoform OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
18	Q00G33	3.06e-61	223	958	0.168	0.120	Q00G33_DROME SnoN2 OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
19	Q00G30	1.50e-60	222	1223	0.168	0.094	Q00G30_DROME Sno oncogene, isoform B OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1
20	A0PDV1	1.73e-57	213	1011	0.164	0.111	A0PDV1_DROME DSki protein long isoform (Fragment) OS=Drosophila melanogaster OX=7227 GN=Snoo PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08782 c-SKI_SMAD_bind	7.3e-35	130.3	c-SKI Smad4 binding domain
2	PF04356 DUF489	1.2e+02	14.0	Protein of unknown function (DUF489)
3	PF02437 Ski_Sno	3.5e-42	153.8	SKI/SNO/DAC family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262160	0.999	Mothers against decapentaplegic homolog 2
2	9606.ENSP00000332973	0.999	Mothers against decapentaplegic homolog 3
3	9606.ENSP00000341551	0.999	Mothers against decapentaplegic homolog 4
4	9606.ENSP00000268712	0.992	Nuclear receptor corepressor 1
5	9606.ENSP00000367797	0.985	Ski oncogene
6	9606.ENSP00000263253	0.962	Histone acetyltransferase p300
7	9606.ENSP00000453872	0.961	E3 ubiquitin-protein ligase Arkadia
8	9606.ENSP00000378402	0.951	Paired amphipathic helix protein Sin3a
9	9606.ENSP00000262435	0.950	E3 ubiquitin-protein ligase SMURF2
10	9606.ENSP00000362649	0.935	Histone deacetylase 1
11	9606.ENSP00000262367	0.932	CREB-binding protein
12	9606.ENSP00000261769	0.923	Cadherin-1
13	9606.ENSP00000362592	0.913	Histone-binding protein RBBP4
14	9606.ENSP00000369131	0.912	Paired amphipathic helix protein Sin3b
15	9606.ENSP00000369424	0.906	Histone-binding protein RBBP7
16	9606.ENSP00000430432	0.904	Histone deacetylase 2
17	9606.ENSP00000296504	0.903	Histone deacetylase complex subunit SAP30
18	9606.ENSP00000234071	0.900	Vitamin K-dependent protein C
19	9606.ENSP00000481842	0.900	Histone deacetylase complex subunit SAP18
20	9606.ENSP00000351250	0.763	E3 ubiquitin-protein ligase TRIM33

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	0.999	protein domain specific binding
GO:0043565	0.999	sequence-specific DNA binding
GO:0042802	0.998	identical protein binding
GO:0140110	0.976	transcription regulator activity
GO:0046332	0.947	SMAD binding
GO:1990837	0.888	sequence-specific double-stranded DNA binding
GO:0008134	0.887	transcription factor binding
GO:0000976	0.881	transcription cis-regulatory region binding
GO:0003700	0.876	DNA-binding transcription factor activity
GO:0140297	0.869	DNA-binding transcription factor binding
GO:0000981	0.865	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.843	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.838	cis-regulatory region sequence-specific DNA binding
GO:0001217	0.834	DNA-binding transcription repressor activity
GO:0001227	0.823	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.797	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0044877	0.780	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.986	regulation of primary metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0009889	0.986	regulation of biosynthetic process
GO:0048523	0.985	negative regulation of cellular process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0006355	0.984	regulation of DNA-templated transcription
GO:0010605	0.975	negative regulation of macromolecule metabolic process
GO:0048518	0.973	positive regulation of biological process
GO:0051172	0.959	negative regulation of nitrogen compound metabolic process
GO:0031324	0.956	negative regulation of cellular metabolic process
GO:0050896	0.943	response to stimulus
GO:0048522	0.943	positive regulation of cellular process
GO:1903507	0.916	negative regulation of nucleic acid-templated transcription
GO:0045892	0.908	negative regulation of DNA-templated transcription
GO:0009987	0.881	cellular process
GO:0032502	0.770	developmental process
GO:0048583	0.720	regulation of response to stimulus
GO:0051239	0.655	regulation of multicellular organismal process
GO:0050793	0.607	regulation of developmental process
GO:0009966	0.591	regulation of signal transduction
GO:0048856	0.575	anatomical structure development
GO:0032501	0.548	multicellular organismal process
GO:0090092	0.534	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051716	0.530	cellular response to stimulus
GO:0070848	0.515	response to growth factor
GO:0006357	0.490	regulation of transcription by RNA polymerase II
GO:0000122	0.471	negative regulation of transcription by RNA polymerase II
GO:0048585	0.419	negative regulation of response to stimulus
GO:0051128	0.402	regulation of cellular component organization
GO:0009968	0.401	negative regulation of signal transduction
GO:0017015	0.373	regulation of transforming growth factor beta receptor signaling pathway
GO:0042221	0.356	response to chemical
GO:0071704	0.352	organic substance metabolic process
GO:0045595	0.346	regulation of cell differentiation
GO:0009893	0.327	positive regulation of metabolic process
GO:0007165	0.318	signal transduction
GO:0044238	0.302	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.986	protein-containing complex
GO:0031974	0.913	membrane-enclosed lumen
GO:0070013	0.878	intracellular organelle lumen
GO:0005737	0.874	cytoplasm
GO:0005654	0.863	nucleoplasm
GO:0005829	0.520	cytosol
GO:0005667	0.467	transcription regulator complex
GO:0012505	0.357	endomembrane system
GO:0016020	0.313	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]