StarFunc result for job id P12814

User Input

>input (892 residues)
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05094	0.869	0.868	4.349E-104	893	0.978	0.976	P05094.pdb.gz	ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus OX=9031 GN=ACTN1 PE=1 SV=3
2	AFDB:P57780	0.896	0.878	4.223E-96	912	0.857	0.838	P57780.pdb.gz	ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus OX=10090 GN=Actn4 PE=1 SV=1
3	AFDB:P20111	0.958	0.952	2.203E-92	897	0.802	0.797	P20111.pdb.gz	ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus OX=9031 GN=ACTN2 PE=2 SV=1
4	AFDB:A0A2R8QBL5	0.942	0.939	1.689E-90	895	0.786	0.783	A0A2R8QBL5.pdb.gz
5	AFDB:L7UZ85	0.883	0.890	1.757E-84	885	0.700	0.705	L7UZ85.pdb.gz	ACTN_DERFA Alpha-actinin OS=Dermatophagoides farinae OX=6954 PE=1 SV=1
6	AFDB:B2R8Y4	0.487	0.483	2.352E-82	901	0.775	0.767	B2R8Y4.pdb.gz	B2R8Y4_HUMAN cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
7	AFDB:P18091	0.402	0.391	5.758E-79	924	0.697	0.673	P18091.pdb.gz	ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster OX=7227 GN=Actn PE=1 SV=2
8	AFDB:Q23158	0.662	0.643	3.839E-74	920	0.619	0.600	Q23158.pdb.gz	Q23158_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
9	AFDB:Q9XVU8	0.544	0.543	6.312E-71	894	0.620	0.619	Q9XVU8.pdb.gz	Q9XVU8_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
10	PDB:1sjjA	0.242	0.250	9.720E-71	863	0.932	0.963	1sjjA.pdb.gz
11	PDB:4d1eA	0.410	0.425	6.972E-67	859	0.775	0.804	4d1eA.pdb.gz
12	AFDB:P05095	0.446	0.459	2.342E-46	861	0.368	0.381	P05095.pdb.gz	ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum OX=44689 GN=abpA PE=1 SV=2
13	PDB:7sx8D	0.202	0.371	4.017E-5	448	0.065	0.129	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:5d43A	0.097	0.432	4.379E-4	150	0.041	0.247	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
15	PDB:3qrxA	0.089	0.423	2.069E-3	145	0.041	0.255	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
16	PDB:2ggmA	0.096	0.438	2.426E-3	149	0.037	0.221	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
17	PDB:1osaA	0.093	0.367	3.471E-3	148	0.043	0.257	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
18	PDB:1a2xA	0.086	0.441	3.612E-3	158	0.040	0.228	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
19	PDB:1ggzA	0.110	0.400	4.773E-3	144	0.047	0.292	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
20	PDB:3wfnB	0.097	0.379	4.966E-3	169	0.041	0.219	3wfnB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3G9	1597	911	0.858	0.840	A0A0S2Z3G9_HUMAN Actinin alpha 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACTN4 PE=2 SV=1
2	A0A8I5ZN92	1493	898	0.794	0.788	A0A8I5ZN92_RAT Actinin alpha 2 OS=Rattus norvegicus OX=10116 GN=Actn2 PE=1 SV=1
3	A0A8I6ARF4	1335	816	0.706	0.772	A0A8I6ARF4_RAT Actinin alpha 2 OS=Rattus norvegicus OX=10116 GN=Actn2 PE=1 SV=1
4	B2R8Y4	1476	901	0.772	0.765	B2R8Y4_HUMAN cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
5	D3ZCV0	1489	876	0.793	0.807	D3ZCV0_RAT Actinin alpha 2 OS=Rattus norvegicus OX=10116 GN=Actn2 PE=1 SV=2
6	F5GXS2	1593	911	0.857	0.839	F5GXS2_HUMAN Actinin alpha 4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=3
7	H2L2C8	1069	823	0.567	0.615	H2L2C8_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
8	H2L2C9	1048	849	0.565	0.594	H2L2C9_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
9	H7C144	1560	906	0.841	0.828	H7C144_HUMAN Actinin alpha 4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2
10	L7UZ85	1311	885	0.695	0.701	ACTN_DERFA Alpha-actinin OS=Dermatophagoides farinae OX=6954 PE=1 SV=1
11	O43707	1597	911	0.858	0.840	ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2
12	O88990	1487	900	0.780	0.773	ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus OX=10090 GN=Actn3 PE=2 SV=1
13	P05094	1816	893	0.975	0.974	ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus OX=9031 GN=ACTN1 PE=1 SV=3
14	P05095	595	861	0.371	0.384	ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum OX=44689 GN=abpA PE=1 SV=2
15	P12814	1863	892	1.000	1.000	ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2
16	P18091	1309	924	0.691	0.667	ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster OX=7227 GN=Actn PE=1 SV=2
17	P20111	1517	897	0.803	0.798	ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus OX=9031 GN=ACTN2 PE=2 SV=1
18	P35609	1503	894	0.795	0.793	ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens OX=9606 GN=ACTN2 PE=1 SV=1
19	P57780	1600	912	0.858	0.839	ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus OX=10090 GN=Actn4 PE=1 SV=1
20	Q08043	1473	901	0.770	0.762	ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens OX=9606 GN=ACTN3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	0.0014	29.7	CAMSAP CH domain
2	PF00307 CH	8.4e-50	178.9	Calponin homology (CH) domain
3	PF02734 Dak2	2.4e+02	13.0	DAK2 domain
4	PF00036 EF-hand_1	2.8e-06	37.5	EF hand
5	PF13202 EF-hand_5	9.1	17.2	EF hand
6	PF13405 EF-hand_6	0.00053	30.6	EF-hand domain
7	PF13499 EF-hand_7	0.0011	30.7	EF-hand domain pair
8	PF13833 EF-hand_8	0.092	23.9	EF-hand domain pair
9	PF08726 EFhand_Ca_insen	4.3e-24	95.7	Ca2+ insensitive EF hand
10	PF00435 Spectrin	3.8e-70	244.4	Spectrin repeat
11	PF08869 XisI	1.6e+02	14.1	XisI protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9986.ENSOCUP00000019356

Rank	PPI partner	STRING score	Description
1	9986.ENSOCUP00000002751	0.996	Vinculin
2	9986.ENSOCUP00000020653	0.985	annotation not available
3	9986.ENSOCUP00000006694	0.972	Associates with the cytoplasmic domain of a variety of cadherins. The association of catenins to cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. Can associate with both E- and N-cadherins. Originally believed to be a stable component of E-cadherin/catenin adhesion complexes and to mediate the linkage of cadherins to the actin cytoskeleton at adherens junctions. In contrast, cortical actin was found to be much more dynamic than E-cadherin/catenin complexes and CTNNA1 was shown [...]
4	9986.ENSOCUP00000018567	0.963	Zyxin
5	9986.ENSOCUP00000003143	0.948	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
6	9986.ENSOCUP00000005083	0.948	Belongs to the actin family.
7	9986.ENSOCUP00000010927	0.945	LIM domain binding 3
8	9986.ENSOCUP00000013475	0.937	Synovial sarcoma, X breakpoint 2 interacting protein
9	9986.ENSOCUP00000026737	0.933	Catenin (cadherin-associated protein), alpha 2
10	9986.ENSOCUP00000020954	0.929	Uncharacterized protein
11	9986.ENSOCUP00000008817	0.910	Talin 1
12	9986.ENSOCUP00000007287	0.908	Catenin (cadherin-associated protein), alpha 3
13	9986.ENSOCUP00000010163	0.898	Belongs to the tropomyosin family.
14	9986.ENSOCUP00000009789	0.895	Belongs to the integrin alpha chain family.
15	9986.ENSOCUP00000012137	0.887	Tropomyosin alpha-1 chain
16	9986.ENSOCUP00000011732	0.885	PDZ and LIM domain 1
17	9986.ENSOCUP00000015352	0.881	Actinin, alpha 2
18	9986.ENSOCUP00000020096	0.867	Integrin beta
19	9986.ENSOCUP00000001263	0.862	Catenin beta 1
20	9986.ENSOCUP00000014521	0.861	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.996	cytoskeletal protein binding
GO:0044877	0.938	protein-containing complex binding
GO:0003779	0.806	actin binding
GO:0042802	0.624	identical protein binding
GO:0019904	0.534	protein domain specific binding
GO:0051015	0.495	actin filament binding
GO:0017166	0.447	vinculin binding
GO:0042803	0.437	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.957	biological regulation
GO:0016043	0.838	cellular component organization
GO:0050794	0.821	regulation of cellular process
GO:0030036	0.814	actin cytoskeleton organization
GO:0097435	0.658	supramolecular fiber organization
GO:0030154	0.611	cell differentiation
GO:0048856	0.607	anatomical structure development
GO:0050896	0.597	response to stimulus
GO:0065009	0.529	regulation of molecular function
GO:0022607	0.484	cellular component assembly
GO:0051179	0.478	localization
GO:0051716	0.375	cellular response to stimulus
GO:0031032	0.307	actomyosin structure organization
GO:0051234	0.301	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005856	0.997	cytoskeleton
GO:0015629	0.992	actin cytoskeleton
GO:0005829	0.989	cytosol
GO:0043292	0.989	contractile fiber
GO:0032991	0.988	protein-containing complex
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0030054	0.981	cell junction
GO:0071944	0.975	cell periphery
GO:0016020	0.972	membrane
GO:0120025	0.957	plasma membrane bounded cell projection
GO:0030016	0.956	myofibril
GO:0001725	0.956	stress fiber
GO:0005886	0.944	plasma membrane
GO:0030017	0.940	sarcomere
GO:0030863	0.915	cortical cytoskeleton
GO:0030055	0.903	cell-substrate junction
GO:0031674	0.894	I band
GO:0005925	0.893	focal adhesion
GO:0030018	0.851	Z disc
GO:0031143	0.752	pseudopodium
GO:0031974	0.751	membrane-enclosed lumen
GO:0031981	0.735	nuclear lumen
GO:0012505	0.732	endomembrane system
GO:0005576	0.728	extracellular region
GO:0005654	0.725	nucleoplasm
GO:0016604	0.669	nuclear body
GO:0031982	0.651	vesicle
GO:0045202	0.385	synapse
GO:0005615	0.383	extracellular space
GO:0043005	0.333	neuron projection
GO:0005884	0.312	actin filament
GO:0098862	0.311	cluster of actin-based cell projections
GO:0031252	0.307	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]