StarFunc result for job id P12821

User Input

>input (1306 residues)
MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV
LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRI
IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR
SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL
EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF
PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI
GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL
KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS
QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRI
IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKY
EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER
LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD
VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS
ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE
ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY
FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW
LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7q3yA	0.796	0.859	0.000	1201	0.917	0.998	7q3yA.pdb.gz	Cryo-EM reveals mechanisms of angiotensin I-converting enzyme allostery and dimerization.
2	AFDB:P12821	1.000	1.000	0.000	1306	1.000	1.000	P12821.pdb.gz	ACE_HUMAN Angiotensin-converting enzyme OS=Homo sapiens OX=9606 GN=ACE PE=1 SV=1
3	AFDB:P12822	0.948	0.946	0.000	1310	0.878	0.876	P12822.pdb.gz	ACE_RABIT Angiotensin-converting enzyme OS=Oryctolagus cuniculus OX=9986 GN=ACE PE=1 SV=3
4	AFDB:P47820	0.967	0.962	0.000	1313	0.845	0.841	P47820.pdb.gz	ACE_RAT Angiotensin-converting enzyme OS=Rattus norvegicus OX=10116 GN=Ace PE=1 SV=1
5	AFDB:Q10751	0.878	0.960	0.000	1193	0.625	0.684	Q10751.pdb.gz	ACE_CHICK Angiotensin-converting enzyme OS=Gallus gallus OX=9031 GN=ACE PE=2 SV=2
6	AFDB:D0G895	0.451	0.796	1.239E-57	737	0.276	0.488	D0G895.pdb.gz	ACE3_MOUSE Angiotensin-converting enzyme-like protein Ace3 OS=Mus musculus OX=10090 GN=Ace3 PE=1 SV=1
7	AFDB:Q10714	0.438	0.925	9.219E-46	615	0.200	0.424	Q10714.pdb.gz	ACE_DROME Angiotensin-converting enzyme OS=Drosophila melanogaster OX=7227 GN=Ance PE=1 SV=3
8	AFDB:Q58DD0	0.438	0.708	2.401E-45	804	0.198	0.321	Q58DD0.pdb.gz	ACE2_BOVIN Angiotensin-converting enzyme 2 OS=Bos taurus OX=9913 GN=ACE2 PE=1 SV=1
9	AFDB:Q5EGZ1	0.439	0.709	2.798E-45	805	0.202	0.328	Q5EGZ1.pdb.gz	ACE2_RAT Angiotensin-converting enzyme 2 OS=Rattus norvegicus OX=10116 GN=Ace2 PE=1 SV=1
10	AFDB:A0A1S3APE5	0.435	0.700	3.388E-45	804	0.199	0.323	A0A1S3APE5.pdb.gz	A0A1S3APE5_ERIEU Angiotensin-converting enzyme OS=Erinaceus europaeus OX=9365 GN=ACE2 PE=1 SV=1
11	AFDB:Q56NL1	0.437	0.705	5.791E-45	805	0.199	0.323	Q56NL1.pdb.gz	ACE2_PAGLA Angiotensin-converting enzyme 2 OS=Paguma larvata OX=9675 GN=ACE2 PE=1 SV=1
12	PDB:5a2rA	0.442	0.960	1.300E-44	597	0.202	0.442	5a2rA.pdb.gz	A New High-Resolution Crystal Structure of the Drosophila Melanogaster Angiotensin Converting Enzyme Homologue, Ance.
13	PDB:7c8jA	0.417	0.748	1.959E-42	707	0.201	0.371	7c8jA.pdb.gz	Cross-species recognition of SARS-CoV-2 to bat ACE2.
14	PDB:7v61B	0.410	0.689	2.857E-41	751	0.191	0.333	7v61B.pdb.gz
15	PDB:1ka2A	0.270	0.626	9.457E-8	497	0.074	0.193	1ka2A.pdb.gz	Crystal Structure of a Novel Carboxypeptidase from the Hyperthermophilic Archaeon Pyrococcus furiosus
16	PDB:5wvuA	0.282	0.649	1.497E-7	510	0.070	0.178	5wvuA.pdb.gz	Insight into the transition between the open and closed conformations of Thermus thermophilus carboxypeptidase.
17	PDB:5lv0A	0.290	0.523	1.745E-7	666	0.075	0.147	5lv0A.pdb.gz	Structural and functional analysis of Neurolysin, a new component of the mitochondrial peptidolytic network
18	PDB:2o36A	0.291	0.521	3.220E-7	654	0.072	0.144	2o36A.pdb.gz	Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase.
19	PDB:3hq2B	0.264	0.608	7.475E-7	497	0.063	0.165	3hq2B.pdb.gz	Insight into the substrate length restriction of M32 carboxypeptidases: Characterization of two distinct subfamilies.
20	PDB:4ka7A	0.325	0.571	3.082E-6	695	0.074	0.138	4ka7A.pdb.gz	Organellar oligopeptidase (OOP) provides a complementary pathway for targeting peptide degradation in mitochondria and chloroplasts.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D0G895	0.0	602	737	0.217	0.384	ACE3_MOUSE Angiotensin-converting enzyme-like protein Ace3 OS=Mus musculus OX=10090 GN=Ace3 PE=1 SV=1
2	F1RRW5	0.0	2316	1309	0.833	0.831	ACE_PIG Angiotensin-converting enzyme OS=Sus scrofa OX=9823 GN=ACE PE=1 SV=3
3	P09470	0.0	2321	1312	0.835	0.831	ACE_MOUSE Angiotensin-converting enzyme OS=Mus musculus OX=10090 GN=Ace PE=1 SV=3
4	P12821	0.0	2722	1306	1.000	1.000	ACE_HUMAN Angiotensin-converting enzyme OS=Homo sapiens OX=9606 GN=ACE PE=1 SV=1
5	P12822	0.0	2376	1310	0.863	0.860	ACE_RABIT Angiotensin-converting enzyme OS=Oryctolagus cuniculus OX=9986 GN=ACE PE=1 SV=3
6	P47820	0.0	2331	1313	0.846	0.842	ACE_RAT Angiotensin-converting enzyme OS=Rattus norvegicus OX=10116 GN=Ace PE=1 SV=1
7	Q10751	0.0	1872	1281	0.665	0.678	ACE_CHICK Angiotensin-converting enzyme OS=Gallus gallus OX=9031 GN=ACE PE=2 SV=2
8	Q10714	2.12e-177	540	615	0.202	0.429	ACE_DROME Angiotensin-converting enzyme OS=Drosophila melanogaster OX=7227 GN=Ance PE=1 SV=3
9	A0NFU8	5.28e-176	540	698	0.200	0.374	A0NFU8_ANOGA Angiotensin-converting enzyme (Fragment) OS=Anopheles gambiae OX=7165 GN=ANCE2 PE=1 SV=2
10	Q8R0I0	2.21e-173	536	805	0.206	0.334	ACE2_MOUSE Angiotensin-converting enzyme 2 OS=Mus musculus OX=10090 GN=Ace2 PE=1 SV=1
11	A0A1S3APE5	6.38e-172	533	804	0.198	0.322	A0A1S3APE5_ERIEU Angiotensin-converting enzyme OS=Erinaceus europaeus OX=9365 GN=ACE2 PE=1 SV=1
12	G1PXH7	2.61e-171	531	807	0.202	0.327	G1PXH7_MYOLU Angiotensin-converting enzyme OS=Myotis lucifugus OX=59463 GN=ACE2 PE=1 SV=1
13	E2DHI3	8.29e-171	530	805	0.202	0.328	E2DHI3_RHIMR Angiotensin-converting enzyme OS=Rhinolophus macrotis OX=196889 GN=ACE2 PE=1 SV=1
14	Q56NL1	2.33e-170	529	805	0.201	0.327	ACE2_PAGLA Angiotensin-converting enzyme 2 OS=Paguma larvata OX=9675 GN=ACE2 PE=1 SV=1
15	Q5EGZ1	3.68e-167	520	805	0.198	0.320	ACE2_RAT Angiotensin-converting enzyme 2 OS=Rattus norvegicus OX=10116 GN=Ace2 PE=1 SV=1
16	Q58DD0	5.41e-166	517	804	0.200	0.325	ACE2_BOVIN Angiotensin-converting enzyme 2 OS=Bos taurus OX=9913 GN=ACE2 PE=1 SV=1
17	Q9BYF1	6.06e-163	509	805	0.193	0.313	ACE2_HUMAN Angiotensin-converting enzyme 2 OS=Homo sapiens OX=9606 GN=ACE2 PE=1 SV=2
18	D8WU01	1.19e-161	506	805	0.190	0.308	D8WU01_ROULE Angiotensin-converting enzyme OS=Rousettus leschenaultii OX=9408 GN=ACE2 PE=1 SV=1
19	Q9VLJ6	3.18e-154	480	630	0.187	0.387	ACER_DROME Angiotensin-converting enzyme-related protein OS=Drosophila melanogaster OX=7227 GN=Acer PE=1 SV=1
20	Q18581	4.21e-70	256	906	0.130	0.188	ACN1_CAEEL Inactive angiotensin-converting enzyme-related protein OS=Caenorhabditis elegans OX=6239 GN=acn-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15631 Imm-NTF2-2	1.2e+02	14.3	NTF2 fold immunity protein
2	PF01401 Peptidase_M2	0	1847.3	Angiotensin-converting enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290866

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355627	0.998	Angiotensinogen
2	9606.ENSP00000265023	0.982	Kininogen-1
3	9606.ENSP00000272190	0.967	Renin
4	9606.ENSP00000400175	0.963	Transforming protein RhoA
5	9606.ENSP00000285735	0.932	Rho-related GTP-binding protein RhoC
6	9606.ENSP00000419422	0.924	Type-1 angiotensin II receptor
7	9606.ENSP00000360973	0.916	Type-2 angiotensin II receptor
8	9606.ENSP00000450482	0.878	B2 bradykinin receptor
9	9606.ENSP00000418525	0.865	Neprilysin
10	9606.ENSP00000350815	0.863	Mineralocorticoid receptor
11	9606.ENSP00000295897	0.859	Serum albumin
12	9606.ENSP00000380432	0.858	Insulin
13	9606.ENSP00000255030	0.855	C-reactive protein
14	9606.ENSP00000264758	0.848	Alpha-adducin
15	9606.ENSP00000250378	0.823	Chymase
16	9606.ENSP00000297494	0.804	Nitric oxide synthase, endothelial
17	9606.ENSP00000368683	0.804	Endothelin-1
18	9606.ENSP00000387760	0.802	Angiotensin-converting enzyme
19	9606.ENSP00000326159	0.794	Kallikrein-4
20	9606.ENSP00000287820	0.785	Peroxisome proliferator-activated receptor gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.997	binding
GO:0008238	0.997	exopeptidase activity
GO:0005515	0.990	protein binding
GO:0008241	0.980	peptidyl-dipeptidase activity
GO:0008237	0.858	metallopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0009987	0.988	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0006807	0.941	nitrogen compound metabolic process
GO:0032501	0.906	multicellular organismal process
GO:0043603	0.906	amide metabolic process
GO:0065008	0.905	regulation of biological quality
GO:0050789	0.894	regulation of biological process
GO:1901564	0.894	organonitrogen compound metabolic process
GO:0050794	0.806	regulation of cellular process
GO:0050896	0.749	response to stimulus
GO:0044237	0.725	cellular metabolic process
GO:0009056	0.695	catabolic process
GO:0042445	0.695	hormone metabolic process
GO:0044238	0.636	primary metabolic process
GO:0048856	0.596	anatomical structure development
GO:0003008	0.562	system process
GO:0048518	0.541	positive regulation of biological process
GO:0048522	0.451	positive regulation of cellular process
GO:0043170	0.433	macromolecule metabolic process
GO:0003013	0.394	circulatory system process
GO:0051716	0.381	cellular response to stimulus
GO:0008015	0.371	blood circulation
GO:0006518	0.364	peptide metabolic process
GO:0007275	0.344	multicellular organism development
GO:0051239	0.335	regulation of multicellular organismal process
GO:0019538	0.328	protein metabolic process
GO:0019222	0.325	regulation of metabolic process
GO:0042221	0.309	response to chemical
GO:0080090	0.304	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.975	membrane-bounded organelle
GO:0005622	0.970	intracellular anatomical structure
GO:0012505	0.968	endomembrane system
GO:0005737	0.963	cytoplasm
GO:0005576	0.961	extracellular region
GO:0043229	0.904	intracellular organelle
GO:0005615	0.876	extracellular space
GO:0031982	0.876	vesicle
GO:0043231	0.874	intracellular membrane-bounded organelle
GO:1903561	0.796	extracellular vesicle
GO:0070062	0.780	extracellular exosome
GO:0031410	0.725	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.997	Acting on peptide bonds (peptidases).
EC:3.4.15.-	0.980	Peptidyl-dipeptidases.

[back to server]