StarFunc result for job id P12830

User Input

>input (882 residues)
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IFF8	0.666	0.669	0.000	877	0.519	0.522	A0A0R4IFF8.pdb.gz
2	AFDB:F1LMI3	0.600	0.641	0.000	822	0.527	0.566	F1LMI3.pdb.gz	F1LMI3_RAT Cadherin 3 OS=Rattus norvegicus OX=10116 GN=Cdh3 PE=4 SV=3
3	AFDB:F1PAA9	0.777	0.774	0.000	885	0.825	0.823	F1PAA9.pdb.gz	CADH1_CANLF Cadherin-1 OS=Canis lupus familiaris OX=9615 GN=CDH1 PE=1 SV=2
4	AFDB:P12830	1.000	1.000	0.000	882	1.000	1.000	P12830.pdb.gz	CADH1_HUMAN Cadherin-1 OS=Homo sapiens OX=9606 GN=CDH1 PE=1 SV=3
5	AFDB:P22223	0.626	0.665	0.000	829	0.540	0.574	P22223.pdb.gz	CADH3_HUMAN Cadherin-3 OS=Homo sapiens OX=9606 GN=CDH3 PE=1 SV=2
6	AFDB:P33148	0.747	0.749	0.000	880	0.574	0.575	P33148.pdb.gz	CADHF_XENLA EP-cadherin OS=Xenopus laevis OX=8355 PE=1 SV=2
7	AFDB:Q9R0T4	0.816	0.813	0.000	886	0.812	0.808	Q9R0T4.pdb.gz	CADH1_RAT Cadherin-1 OS=Rattus norvegicus OX=10116 GN=Cdh1 PE=1 SV=1
8	AFDB:P55283	0.597	0.575	8.213E-103	916	0.471	0.453	P55283.pdb.gz	CADH4_HUMAN Cadherin-4 OS=Homo sapiens OX=9606 GN=CDH4 PE=2 SV=2
9	AFDB:Q90275	0.602	0.595	2.901E-100	893	0.465	0.459	Q90275.pdb.gz	CADH2_DANRE Cadherin-2 OS=Danio rerio OX=7955 GN=cdh2 PE=1 SV=2
10	AFDB:P15116	0.620	0.605	4.648E-100	906	0.484	0.471	P15116.pdb.gz	CADH2_MOUSE Cadherin-2 OS=Mus musculus OX=10090 GN=Cdh2 PE=1 SV=2
11	PDB:6velC	0.236	0.984	1.324E-36	209	0.237	1.000	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
12	PDB:7sqcO0	0.179	0.147	2.223E-16	1140	0.085	0.066	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:4aq1A	0.121	0.141	1.255E-14	721	0.092	0.112	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:1e07A	0.138	0.165	7.870E-13	642	0.091	0.125	1e07A.pdb.gz
15	PDB:5oj2B	0.140	0.170	1.023E-12	692	0.082	0.104	5oj2B.pdb.gz
16	PDB:5a42A	0.110	0.077	1.646E-10	1597	0.109	0.060	5a42A.pdb.gz
17	PDB:7nycA	0.103	0.067	1.341E-8	1542	0.098	0.056	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:4ziqA	0.100	0.071	3.443E-8	1450	0.098	0.059	4ziqA.pdb.gz
19	PDB:4rtdA	0.097	0.082	9.316E-8	1122	0.084	0.066	4rtdA.pdb.gz
20	PDB:7q1yA	0.100	0.072	1.211E-7	1374	0.074	0.047	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WX99	639	822	0.443	0.476	A0A087WX99_HUMAN Cadherin 4 OS=Homo sapiens OX=9606 GN=CDH4 PE=1 SV=1
2	A1L1M6	646	931	0.464	0.439	A1L1M6_DANRE Cadherin 4, retinal OS=Danio rerio OX=7955 GN=R-cadherin PE=2 SV=1
3	A5D8W4	1273	647	0.703	0.958	A5D8W4_HUMAN CDH1 protein OS=Homo sapiens OX=9606 GN=CDH1 PE=1 SV=1
4	F1LMI3	811	822	0.505	0.541	F1LMI3_RAT Cadherin 3 OS=Rattus norvegicus OX=10116 GN=Cdh3 PE=4 SV=3
5	F1PAA9	1379	885	0.816	0.814	CADH1_CANLF Cadherin-1 OS=Canis lupus familiaris OX=9615 GN=CDH1 PE=1 SV=2
6	P08641	1001	887	0.618	0.614	CADH1_CHICK Cadherin-1 OS=Gallus gallus OX=9031 GN=CDH1 PE=1 SV=2
7	P09803	1352	884	0.816	0.814	CADH1_MOUSE Cadherin-1 OS=Mus musculus OX=10090 GN=Cdh1 PE=1 SV=1
8	P10287	811	822	0.501	0.538	CADH3_MOUSE Cadherin-3 OS=Mus musculus OX=10090 GN=Cdh3 PE=1 SV=2
9	P10288	669	912	0.473	0.457	CADH2_CHICK Cadherin-2 OS=Gallus gallus OX=9031 GN=CDH2 PE=1 SV=1
10	P12830	1813	882	1.000	1.000	CADH1_HUMAN Cadherin-1 OS=Homo sapiens OX=9606 GN=CDH1 PE=1 SV=3
11	P15116	686	906	0.478	0.466	CADH2_MOUSE Cadherin-2 OS=Mus musculus OX=10090 GN=Cdh2 PE=1 SV=2
12	P19022	686	906	0.475	0.462	CADH2_HUMAN Cadherin-2 OS=Homo sapiens OX=9606 GN=CDH2 PE=1 SV=4
13	P22223	838	829	0.548	0.583	CADH3_HUMAN Cadherin-3 OS=Homo sapiens OX=9606 GN=CDH3 PE=1 SV=2
14	P33148	941	880	0.575	0.576	CADHF_XENLA EP-cadherin OS=Xenopus laevis OX=8355 PE=1 SV=2
15	P39038	682	913	0.467	0.451	CADH4_MOUSE Cadherin-4 OS=Mus musculus OX=10090 GN=Cdh4 PE=2 SV=1
16	P55283	683	916	0.467	0.450	CADH4_HUMAN Cadherin-4 OS=Homo sapiens OX=9606 GN=CDH4 PE=2 SV=2
17	Q90275	655	893	0.466	0.460	CADH2_DANRE Cadherin-2 OS=Danio rerio OX=7955 GN=cdh2 PE=1 SV=2
18	Q90Z37	810	864	0.526	0.537	Q90Z37_DANRE Cadherin 1, type 1, E-cadherin (Epithelial) precursor OS=Danio rerio OX=7955 GN=E-cadherin PE=1 SV=1
19	Q9R0T4	1377	886	0.813	0.809	CADH1_RAT Cadherin-1 OS=Rattus norvegicus OX=10116 GN=Cdh1 PE=1 SV=1
20	Q9Z1Y3	683	906	0.476	0.464	CADH2_RAT Cadherin-2 OS=Rattus norvegicus OX=10116 GN=Cdh2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	2.2e-80	276.5	Cadherin domain
2	PF08266 Cadherin_2	0.033	25.3	Cadherin-like
3	PF16184 Cadherin_3	89	14.4	Cadherin-like
4	PF08758 Cadherin_pro	9e-31	117.2	Cadherin prodomain like
5	PF01049 CADH_Y-type_LIR	1.2e-26	103.9	Cadherin, Y-type LIR-motif
6	PF08705 Gag_p6	2.1e+02	13.6	Gag protein p6
7	PF17756 RET_CLD1	0.023	26.4	RET Cadherin like domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261769

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000211998	0.999	Vinculin
2	9606.ENSP00000263087	0.999	Integrin alpha-E
3	9606.ENSP00000268182	0.999	Ras GTPase-activating-like protein IQGAP1
4	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
5	9606.ENSP00000304669	0.999	Catenin alpha-1
6	9606.ENSP00000317272	0.999	Hepatocyte growth factor receptor
7	9606.ENSP00000344456	0.999	Catenin beta-1
8	9606.ENSP00000349477	0.999	Killer cell lectin-like receptor subfamily G member 1
9	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000377508	0.999	Junction plakoglobin
11	9606.ENSP00000382004	0.999	Catenin delta-1
12	9606.ENSP00000401277	0.999	E3 ubiquitin-protein ligase Hakai
13	9606.ENSP00000268035	0.997	Insulin-like growth factor 1 receptor
14	9606.ENSP00000375960	0.997	Afadin
15	9606.ENSP00000451300	0.997	Protein numb homolog
16	9606.ENSP00000244050	0.993	Zinc finger protein SNAI1
17	9606.ENSP00000281537	0.993	Tight junction protein ZO-1
18	9606.ENSP00000326366	0.993	Presenilin-1
19	9606.ENSP00000380034	0.990	Zinc finger protein SNAI2
20	9606.ENSP00000311032	0.989	Caspase-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0045296	0.902	cadherin binding
GO:0042802	0.883	identical protein binding
GO:0008013	0.829	beta-catenin binding
GO:0045295	0.424	gamma-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007155	0.983	cell adhesion
GO:0050794	0.963	regulation of cellular process
GO:0050896	0.956	response to stimulus
GO:0098609	0.952	cell-cell adhesion
GO:0071840	0.881	cellular component organization or biogenesis
GO:0048518	0.864	positive regulation of biological process
GO:0048522	0.854	positive regulation of cellular process
GO:0016043	0.838	cellular component organization
GO:0051716	0.763	cellular response to stimulus
GO:0019222	0.753	regulation of metabolic process
GO:0060255	0.732	regulation of macromolecule metabolic process
GO:0042221	0.715	response to chemical
GO:0048519	0.688	negative regulation of biological process
GO:0032501	0.680	multicellular organismal process
GO:0032502	0.672	developmental process
GO:0048856	0.660	anatomical structure development
GO:0080090	0.623	regulation of primary metabolic process
GO:0051171	0.614	regulation of nitrogen compound metabolic process
GO:0031323	0.602	regulation of cellular metabolic process
GO:0048523	0.588	negative regulation of cellular process
GO:0007275	0.497	multicellular organism development
GO:0010468	0.463	regulation of gene expression
GO:0009893	0.445	positive regulation of metabolic process
GO:0010604	0.434	positive regulation of macromolecule metabolic process
GO:0023051	0.421	regulation of signaling
GO:0010646	0.419	regulation of cell communication
GO:0048583	0.416	regulation of response to stimulus
GO:0007154	0.406	cell communication
GO:0051239	0.385	regulation of multicellular organismal process
GO:0009889	0.384	regulation of biosynthetic process
GO:0031325	0.383	positive regulation of cellular metabolic process
GO:0048731	0.376	system development
GO:0031326	0.372	regulation of cellular biosynthetic process
GO:0009966	0.365	regulation of signal transduction
GO:0051173	0.352	positive regulation of nitrogen compound metabolic process
GO:0023052	0.333	signaling
GO:0019219	0.332	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.323	regulation of RNA metabolic process
GO:0010556	0.322	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.997	cell junction
GO:0005737	0.971	cytoplasm
GO:0043231	0.815	intracellular membrane-bounded organelle
GO:0070161	0.720	anchoring junction
GO:0005911	0.694	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]