StarFunc result for job id P12882

User Input

>input (1939 residues)
MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPKESFVKATVQSREGGKV
TAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNAEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEVTSGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIEILGFTSDERVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQNLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNAVGALAKAVYDKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLIHYAGTVDYNIAGWLDKN
KDPLNETVVGLYQKSAMKTLALLFVGATGAEAEAGGGKKGGKKKGSSFQTVSALFRENLN
KLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEM
RDEKLAQLITRTQAMCRGFLARVEYQKMVERRESIFCIQYNVRAFMNVKHWPWMKLYFKI
KPLLKSAETEKEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEAD
SLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDD
LELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDK
VNTLTKAKIKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESTMDIENDKQQL
DEKLKKKEFEMSGLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQR
SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKH
ADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLEKMCRALEDQL
SEIKTKEEEQQRLINDLTAQRARLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELK
RQLEEEIKAKSALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYE
TDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTN
AACAALDKKQRNFDKILAEWKQKCEETHAELEASQKESRSLSTELFKIKNAYEESLDQLE
TLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSELQAALEEAEASLEHEEG
KILRIQLELNQVKSEVDRKIAEKDEEIDQMKRNHIRIVESMQSTLDAEIRSRNDAIRLKK
KMEGDLNEMEIQLNHANRMAAEALRNYRNTQAILKDTQLHLDDALRSQEDLKEQLAMVER
RANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQ
IQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHR
LDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVKGLRKHERKVKELTYQTEE
DRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNVNLSKFRRIQHELEEAEERADIAESQ
VNKLRVKSREVHTKIISEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pa0A	0.340	0.658	0.000	974	0.321	0.640	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
2	AFDB:A0A0G2JY53	0.695	0.704	0.000	1915	0.539	0.546	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
3	AFDB:A0A0N4STT5	0.682	0.660	0.000	2008	0.788	0.761	A0A0N4STT5.pdb.gz
4	AFDB:A7E2Y1	0.667	0.653	0.000	1983	0.670	0.656	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
5	AFDB:B1AR69	0.727	0.727	0.000	1938	0.824	0.825	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
6	AFDB:B3DFS9	0.682	0.671	0.000	1974	0.398	0.391	B3DFS9.pdb.gz
7	AFDB:B8A568	0.757	0.758	0.000	1937	0.817	0.818	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
8	AFDB:B8JLS3	0.720	0.721	0.000	1936	0.759	0.760	B8JLS3.pdb.gz
9	AFDB:E7FD18	0.712	0.710	0.000	1945	0.716	0.714	E7FD18.pdb.gz
10	AFDB:F1QC64	0.642	0.710	0.000	1749	0.353	0.391	F1QC64.pdb.gz
11	AFDB:F1R3G4	0.686	0.669	0.000	1992	0.386	0.376	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
12	PDB:4pa0B	0.341	0.698	6.405E-103	920	0.314	0.661	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.340	0.675	2.313E-97	952	0.311	0.633	4p7hB.pdb.gz
14	PDB:5tbyA	0.367	0.710	2.723E-95	954	0.397	0.806	5tbyA.pdb.gz
15	PDB:7mf3B	0.363	0.763	3.363E-65	896	0.224	0.485	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.343	0.655	1.015E-60	995	0.135	0.263	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.363	0.818	1.070E-54	817	0.121	0.286	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6fyxo	0.040	0.090	8.773E-2	529	0.033	0.121	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:7wrgA	0.041	0.082	2.211E-1	812	0.025	0.059	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
20	PDB:1k9aB	0.023	0.088	3.264E-1	441	0.003	0.011	1k9aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2098	1922	0.556	0.561	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	3690	1912	0.938	0.951	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	3820	1937	0.962	0.963	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	3737	1939	0.949	0.949	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	3111	1938	0.790	0.790	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	691	1948	0.214	0.213	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	2536	1941	0.673	0.672	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1280	1972	0.400	0.394	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	2541	1983	0.671	0.657	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	3249	1938	0.825	0.825	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	3130	1939	0.790	0.790	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	2568	1941	0.671	0.671	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	3194	1937	0.818	0.819	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	3706	1939	0.939	0.939	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	3856	1943	0.969	0.967	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	3138	1938	0.797	0.798	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1229	1992	0.388	0.378	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	2507	1929	0.658	0.661	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	3709	1942	0.943	0.941	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	3719	1942	0.945	0.944	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	3.2e+02	13.0	AAA domain
2	PF19220 Crescentin	2.9e+02	11.9	Crescentin protein
3	PF00612 IQ	11	17.1	IQ calmodulin-binding motif
4	PF00063 Myosin_head	7e-282	948.3	Myosin head (motor domain)
5	PF02736 Myosin_N	7.2e-12	56.2	Myosin N-terminal SH3-like domain
6	PF01576 Myosin_tail_1	3.2e-159	543.6	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307280	0.983	Myosin light chain 1/3, skeletal muscle isoform
2	9606.ENSP00000325239	0.980	Myosin light chain, phosphorylatable, fast skeletal muscle
3	9606.ENSP00000450385	0.961	Myosin light chain 6B
4	9606.ENSP00000245503	0.958	Myosin-2
5	9606.ENSP00000279022	0.952	Myosin regulatory light polypeptide 9
6	9606.ENSP00000379210	0.945	Myosin light chain 3
7	9606.ENSP00000383023	0.944	Myosin light chain 5
8	9606.ENSP00000384330	0.933	Myosin-8
9	9606.ENSP00000353590	0.926	Myosin-10
10	9606.ENSP00000347507	0.919	Myosin-7
11	9606.ENSP00000470298	0.916	Myosin-14
12	9606.ENSP00000386041	0.915	Myosin-6
13	9606.ENSP00000404570	0.912	Myosin-13
14	9606.ENSP00000216181	0.903	Myosin-9
15	9606.ENSP00000463559	0.896	Myosin regulatory light chain 12B
16	9606.ENSP00000278317	0.881	Troponin T, fast skeletal muscle
17	9606.ENSP00000351022	0.877	Tropomyosin alpha-1 chain
18	9606.ENSP00000443495	0.867	Alpha-actinin-2
19	9606.ENSP00000217652	0.855	Myosin regulatory light chain 12A
20	9606.ENSP00000371331	0.839	Troponin I, fast skeletal muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000146	0.999	microfilament motor activity
GO:0003779	0.886	actin binding
GO:0044877	0.727	protein-containing complex binding
GO:0003824	0.578	catalytic activity
GO:0097159	0.468	organic cyclic compound binding
GO:1901363	0.459	heterocyclic compound binding
GO:0016787	0.429	hydrolase activity
GO:0051015	0.377	actin filament binding
GO:0017111	0.327	ribonucleoside triphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.987	multicellular organismal process
GO:0009987	0.986	cellular process
GO:0003012	0.964	muscle system process
GO:0006936	0.932	muscle contraction
GO:0006941	0.915	striated muscle contraction
GO:0016043	0.907	cellular component organization
GO:0030029	0.900	actin filament-based process
GO:0050896	0.798	response to stimulus
GO:0030036	0.783	actin cytoskeleton organization
GO:0032502	0.745	developmental process
GO:0031034	0.728	myosin filament assembly
GO:0048856	0.687	anatomical structure development
GO:0014823	0.679	response to activity
GO:0065007	0.672	biological regulation
GO:0050789	0.518	regulation of biological process
GO:0061061	0.356	muscle structure development
GO:0050794	0.321	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	0.999	contractile fiber
GO:0032991	0.998	protein-containing complex
GO:0015629	0.998	actin cytoskeleton
GO:0016459	0.974	myosin complex
GO:0005829	0.945	cytosol
GO:0016460	0.826	myosin II complex
GO:0043227	0.778	membrane-bounded organelle
GO:0005859	0.759	muscle myosin complex
GO:0043231	0.732	intracellular membrane-bounded organelle
GO:0030016	0.592	myofibril
GO:0030017	0.408	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.999	myosin ATPase.
EC:3.-.-.-	0.429	Hydrolases.
RHEA:23680	0.327	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.327	nucleoside-triphosphate phosphatase.

[back to server]