StarFunc result for job id P12883

User Input

>input (1935 residues)
MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVT
AETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGL
FCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFG
NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
IYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDP
LNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLL
KSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL
TKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL
KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLEHEEGKILR
AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL
LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTE
VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN
LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL
RAKSRDIGTKGLNEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4p7hB	0.342	0.678	0.000	952	0.376	0.764	4p7hB.pdb.gz
2	PDB:4pa0A	0.343	0.663	0.000	974	0.392	0.779	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
3	PDB:4pa0B	0.343	0.703	0.000	920	0.382	0.804	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
4	PDB:5tbyA	0.369	0.713	0.000	954	0.491	0.996	5tbyA.pdb.gz
5	AFDB:A0A0G2JY53	0.607	0.613	0.000	1915	0.559	0.565	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
6	AFDB:A0A0N4STT5	0.664	0.641	0.000	2008	0.852	0.821	A0A0N4STT5.pdb.gz
7	AFDB:A7E2Y1	0.652	0.637	0.000	1983	0.694	0.677	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
8	AFDB:B1AR69	0.619	0.618	0.000	1938	0.776	0.775	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
9	AFDB:B3DFS9	0.616	0.604	0.000	1974	0.412	0.404	B3DFS9.pdb.gz
10	AFDB:B8A568	0.629	0.628	0.000	1937	0.769	0.768	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
11	AFDB:B8JLS3	0.636	0.635	0.000	1936	0.822	0.822	B8JLS3.pdb.gz
12	AFDB:E7FD18	0.641	0.638	0.000	1945	0.751	0.747	E7FD18.pdb.gz
13	AFDB:F1R3G4	0.606	0.590	0.000	1992	0.401	0.389	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
14	AFDB:G3UW82	0.646	0.644	0.000	1942	0.816	0.813	G3UW82.pdb.gz	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
15	PDB:7mf3B	0.364	0.765	5.620E-67	896	0.233	0.502	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.342	0.653	4.723E-61	995	0.137	0.266	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.362	0.815	1.867E-54	817	0.119	0.283	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6fyxo	0.044	0.101	1.558E-1	529	0.030	0.112	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:4w8fB	0.042	0.036	1.716E-1	2609	0.033	0.025	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
20	PDB:2is4B	0.043	0.082	2.294E-1	632	0.030	0.092	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2160	1922	0.575	0.579	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	3209	1912	0.809	0.819	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	3206	1937	0.806	0.805	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	3225	1939	0.814	0.813	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	3341	1938	0.854	0.852	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	725	1948	0.219	0.218	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	2633	1941	0.699	0.697	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1295	1972	0.409	0.401	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	2623	1983	0.695	0.678	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	3051	1938	0.777	0.776	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	3374	1939	0.855	0.854	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	2661	1941	0.698	0.696	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	3009	1937	0.767	0.767	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	3224	1939	0.813	0.811	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	3216	1943	0.812	0.809	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	3365	1938	0.860	0.859	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1263	1992	0.407	0.396	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	2599	1929	0.683	0.685	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	3229	1942	0.818	0.815	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	3229	1942	0.818	0.815	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	3.5e+02	12.9	AAA domain
2	PF19220 Crescentin	3.1e+02	11.8	Crescentin protein
3	PF00038 Filament	6.2e+02	11.4	Intermediate filament protein
4	PF00612 IQ	8.3	17.5	IQ calmodulin-binding motif
5	PF00063 Myosin_head	5e-289	971.9	Myosin head (motor domain)
6	PF02736 Myosin_N	1.3e-11	55.4	Myosin N-terminal SH3-like domain
7	PF01576 Myosin_tail_1	9.4e-161	548.7	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347507

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228841	0.997	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
2	9606.ENSP00000379210	0.997	Myosin light chain 3
3	9606.ENSP00000442795	0.992	Myosin-binding protein C, cardiac-type
4	9606.ENSP00000290378	0.975	Actin, alpha cardiac muscle 1
5	9606.ENSP00000307280	0.971	Myosin light chain 1/3, skeletal muscle isoform
6	9606.ENSP00000354488	0.961	Troponin I, slow skeletal muscle
7	9606.ENSP00000347055	0.959	Myosin light chain 4
8	9606.ENSP00000450385	0.956	Myosin light chain 6B
9	9606.ENSP00000279022	0.948	Myosin regulatory light polypeptide 9
10	9606.ENSP00000325239	0.946	Myosin light chain, phosphorylatable, fast skeletal muscle
11	9606.ENSP00000383023	0.938	Myosin light chain 5
12	9606.ENSP00000443495	0.933	Alpha-actinin-2
13	9606.ENSP00000386041	0.932	Myosin-6
14	9606.ENSP00000236918	0.929	Troponin T, cardiac muscle
15	9606.ENSP00000353590	0.926	Myosin-10
16	9606.ENSP00000226207	0.919	Myosin-1
17	9606.ENSP00000384330	0.919	Myosin-8
18	9606.ENSP00000245503	0.917	Myosin-2
19	9606.ENSP00000470298	0.916	Myosin-14
20	9606.ENSP00000216181	0.902	Myosin-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000146	0.999	microfilament motor activity
GO:0008092	0.902	cytoskeletal protein binding
GO:0003779	0.867	actin binding
GO:0044877	0.745	protein-containing complex binding
GO:0097159	0.350	organic cyclic compound binding
GO:1901363	0.344	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0003012	0.986	muscle system process
GO:0009987	0.985	cellular process
GO:0006936	0.978	muscle contraction
GO:0032502	0.958	developmental process
GO:0048856	0.954	anatomical structure development
GO:0006941	0.944	striated muscle contraction
GO:0065007	0.897	biological regulation
GO:0030029	0.895	actin filament-based process
GO:0071840	0.889	cellular component organization or biogenesis
GO:0050789	0.885	regulation of biological process
GO:0016043	0.884	cellular component organization
GO:0061061	0.846	muscle structure development
GO:0007275	0.828	multicellular organism development
GO:0050896	0.823	response to stimulus
GO:0030036	0.757	actin cytoskeleton organization
GO:0050905	0.750	neuromuscular process
GO:0048731	0.735	system development
GO:0050879	0.731	multicellular organismal movement
GO:0031034	0.722	myosin filament assembly
GO:0003009	0.699	skeletal muscle contraction
GO:0009653	0.671	anatomical structure morphogenesis
GO:0048869	0.657	cellular developmental process
GO:0072359	0.636	circulatory system development
GO:0030154	0.609	cell differentiation
GO:0042692	0.546	muscle cell differentiation
GO:0050794	0.486	regulation of cellular process
GO:0048513	0.417	animal organ development
GO:0014706	0.331	striated muscle tissue development
GO:0051239	0.319	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	0.998	contractile fiber
GO:0015629	0.997	actin cytoskeleton
GO:0032991	0.996	protein-containing complex
GO:0016459	0.970	myosin complex
GO:0005829	0.771	cytosol
GO:0016460	0.747	myosin II complex
GO:0005859	0.735	muscle myosin complex
GO:0030017	0.689	sarcomere
GO:0043227	0.654	membrane-bounded organelle
GO:0043231	0.552	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.999	myosin ATPase.

[back to server]