StarFunc result for job id P12931

User Input

>input (536 residues)
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E1BIM8	0.844	0.658	4.998E-90	688	0.981	0.765	E1BIM8.pdb.gz	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
2	AFDB:A1A5H8	0.860	0.845	6.598E-81	546	0.744	0.731	A1A5H8.pdb.gz	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
3	AFDB:J3QRU1	0.823	0.805	1.533E-77	548	0.748	0.732	J3QRU1.pdb.gz	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
4	PDB:2h8hA	0.822	0.988	4.653E-77	445	0.828	0.998	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
5	AFDB:F1RDG9	0.848	0.835	1.797E-76	544	0.692	0.682	F1RDG9.pdb.gz	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	AFDB:A5WWJ6	0.835	0.848	1.541E-74	528	0.679	0.689	A5WWJ6.pdb.gz
7	AFDB:F1NQU9	0.815	0.818	1.252E-73	534	0.700	0.702	F1NQU9.pdb.gz	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
8	AFDB:P14234	0.842	0.873	4.638E-73	517	0.642	0.665	P14234.pdb.gz	FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus OX=10090 GN=Fgr PE=1 SV=2
9	AFDB:P09769	0.835	0.846	1.190E-72	529	0.657	0.665	P09769.pdb.gz	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
10	AFDB:P08103	0.823	0.842	1.030E-65	524	0.545	0.557	P08103.pdb.gz	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
11	AFDB:J3KPD6	0.798	0.812	3.093E-65	526	0.549	0.559	J3KPD6.pdb.gz	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
12	PDB:1k9aB	0.461	0.554	2.956E-37	441	0.336	0.408	1k9aB.pdb.gz
13	PDB:4fl2A	0.452	0.437	3.335E-28	555	0.239	0.231	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.445	0.433	1.304E-26	551	0.241	0.234	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:7mfdA	0.423	0.542	5.741E-17	410	0.170	0.222	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:6s73A	0.420	0.805	7.874E-16	269	0.123	0.245	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:8dksA	0.384	0.691	2.130E-15	283	0.151	0.286	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:4krcA	0.393	0.679	3.596E-15	297	0.132	0.239	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:5ufuA	0.398	0.560	1.025E-14	369	0.147	0.214	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:4btfA	0.409	0.520	1.479E-14	413	0.131	0.169	4btfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1A5H8	829	546	0.744	0.731	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
2	E1BIM8	1095	688	0.981	0.765	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
3	F1LM93	829	541	0.756	0.749	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
4	F1NQU9	779	534	0.683	0.685	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	F1RDG9	756	544	0.664	0.654	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	H0Y3C5	605	525	0.545	0.556	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	J3KPD6	603	526	0.543	0.553	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
8	J3QRU1	830	548	0.743	0.726	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	P00523	1052	533	0.942	0.947	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
10	P05480	1104	535	0.989	0.991	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
11	P06239	577	509	0.507	0.534	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
12	P06240	574	509	0.504	0.530	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
13	P06241	761	537	0.675	0.674	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
14	P07947	829	543	0.743	0.733	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
15	P07948	572	512	0.498	0.521	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
16	P08103	600	524	0.522	0.534	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
17	P08631	602	526	0.543	0.553	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5
18	P09324	834	541	0.756	0.749	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
19	P09769	728	529	0.664	0.673	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
20	P12931	1119	536	1.000	1.000	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	11	16.6	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	26	15.2	Haspin like kinase domain
3	PF00069 Pkinase	1.6e-42	157.3	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	2.8e-89	310.4	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	3e-24	96.2	SH2 domain
6	PF00018 SH3_1	3.8e-14	63.3	SH3 domain
7	PF17902 SH3_10	15	17.0	SH3 domain
8	PF07653 SH3_2	1.4e-05	36.1	Variant SH3 domain
9	PF08239 SH3_3	2.2e+02	13.6	Bacterial SH3 domain
10	PF14604 SH3_9	1.7e-08	45.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362680

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.999	Cadherin-1
2	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000264657	0.999	Signal transducer and activator of transcription 3
4	9606.ENSP00000267257	0.999	Paxillin
5	9606.ENSP00000282561	0.999	Gap junction alpha-1 protein
6	9606.ENSP00000300574	0.999	Adapter molecule crk
7	9606.ENSP00000301396	0.999	Proline-, glutamic acid- and leucine-rich protein 1
8	9606.ENSP00000313829	0.999	KH domain-containing, RNA-binding, signal transduction-associated protein 1
9	9606.ENSP00000325120	0.999	Progesterone receptor
10	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
11	9606.ENSP00000339191	0.999	Caveolin-1
12	9606.ENSP00000344456	0.999	Catenin beta-1
13	9606.ENSP00000363822	0.999	Androgen receptor
14	9606.ENSP00000365745	0.999	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
15	9606.ENSP00000379818	0.999	Glutamate receptor ionotropic, NMDA 2A
16	9606.ENSP00000382428	0.999	Disks large homolog 4
17	9606.ENSP00000391669	0.999	Breast cancer anti-estrogen resistance protein 1
18	9606.ENSP00000405330	0.999	Estrogen receptor
19	9606.ENSP00000409581	0.999	Beta-arrestin-1
20	9606.ENSP00000426909	0.999	Receptor of activated protein C kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0005102	0.920	signaling receptor binding
GO:0019899	0.878	enzyme binding
GO:0004715	0.693	non-membrane spanning protein tyrosine kinase activity
GO:0051219	0.444	phosphoprotein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0051716	0.988	cellular response to stimulus
GO:0048518	0.961	positive regulation of biological process
GO:0048522	0.903	positive regulation of cellular process
GO:0007154	0.837	cell communication
GO:0023052	0.832	signaling
GO:0007165	0.803	signal transduction
GO:0071704	0.794	organic substance metabolic process
GO:0044238	0.751	primary metabolic process
GO:0019222	0.751	regulation of metabolic process
GO:0032501	0.746	multicellular organismal process
GO:0032502	0.690	developmental process
GO:0006807	0.687	nitrogen compound metabolic process
GO:0044237	0.687	cellular metabolic process
GO:0043170	0.662	macromolecule metabolic process
GO:0048583	0.648	regulation of response to stimulus
GO:0019538	0.642	protein metabolic process
GO:0048856	0.640	anatomical structure development
GO:0060255	0.580	regulation of macromolecule metabolic process
GO:0042221	0.519	response to chemical
GO:0080090	0.481	regulation of primary metabolic process
GO:0048519	0.480	negative regulation of biological process
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0031323	0.478	regulation of cellular metabolic process
GO:0006468	0.471	protein phosphorylation
GO:0048523	0.462	negative regulation of cellular process
GO:0010604	0.455	positive regulation of macromolecule metabolic process
GO:0071840	0.452	cellular component organization or biogenesis
GO:0010468	0.445	regulation of gene expression
GO:0051173	0.444	positive regulation of nitrogen compound metabolic process
GO:0009966	0.436	regulation of signal transduction
GO:0031325	0.434	positive regulation of cellular metabolic process
GO:0065009	0.415	regulation of molecular function
GO:0051239	0.413	regulation of multicellular organismal process
GO:0016043	0.403	cellular component organization
GO:0007275	0.362	multicellular organism development
GO:0048584	0.351	positive regulation of response to stimulus
GO:0019220	0.336	regulation of phosphate metabolic process
GO:0007166	0.335	cell surface receptor signaling pathway
GO:0031399	0.325	regulation of protein modification process
GO:0051247	0.321	positive regulation of protein metabolic process
GO:0009889	0.310	regulation of biosynthetic process
GO:0050790	0.300	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0043227	0.970	membrane-bounded organelle
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0012505	0.424	endomembrane system
GO:0098857	0.412	membrane microdomain
GO:0065010	0.406	extracellular membrane-bounded organelle
GO:0043228	0.395	non-membrane-bounded organelle
GO:0043232	0.390	intracellular non-membrane-bounded organelle
GO:0045121	0.385	membrane raft
GO:0030054	0.381	cell junction
GO:0098590	0.326	plasma membrane region
GO:0031982	0.307	vesicle
GO:0005634	0.303	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.693	non-specific protein-tyrosine kinase.

[back to server]