StarFunc result for job id P12956

User Input

>input (609 residues)
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPF
DMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELD
QFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDS
AKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKT
RTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHH
YLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEEL
DDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKV
TKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
EALTKHFQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1N4	0.886	0.886	0.000	609	1.000	1.000	A0A024R1N4.pdb.gz
2	AFDB:E9PT85	0.868	0.868	6.180E-104	609	0.831	0.831	E9PT85.pdb.gz	E9PT85_RAT X-ray repair cross complementing 6 OS=Rattus norvegicus OX=10116 GN=Xrcc6 PE=1 SV=1
3	PDB:1jeqA	0.807	0.896	5.021E-94	548	0.900	1.000	1jeqA.pdb.gz
4	AFDB:O93257	0.859	0.829	1.624E-93	632	0.696	0.671	O93257.pdb.gz	XRCC6_CHICK X-ray repair cross-complementing protein 5 OS=Gallus gallus OX=9031 GN=XRCC6 PE=2 SV=1
5	AFDB:A8KC26	0.838	0.836	2.191E-84	610	0.578	0.577	A8KC26.pdb.gz
6	AFDB:Q54MA9	0.758	0.519	1.803E-53	909	0.338	0.227	Q54MA9.pdb.gz	KU70_DICDI ATP-dependent DNA helicase ku70 OS=Dictyostelium discoideum OX=44689 GN=ku70 PE=3 SV=1
7	AFDB:Q9FQ08	0.793	0.778	2.035E-52	621	0.312	0.306	Q9FQ08.pdb.gz	KU70_ARATH ATP-dependent DNA helicase 2 subunit KU70 OS=Arabidopsis thaliana OX=3702 GN=KU70 PE=1 SV=1
8	AFDB:O94395	0.765	0.768	2.103E-48	607	0.269	0.270	O94395.pdb.gz	KU70_SCHPO ATP-dependent DNA helicase II subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pku70 PE=1 SV=1
9	AFDB:Q7F1M0	0.788	0.770	1.217E-46	624	0.304	0.296	Q7F1M0.pdb.gz	KU70_ORYSJ ATP-dependent DNA helicase 2 subunit KU70 OS=Oryza sativa subsp. japonica OX=39947 GN=KU70 PE=1 SV=1
10	AFDB:Q23976	0.720	0.697	1.199E-41	631	0.235	0.227	Q23976.pdb.gz	KU70_DROME ATP-dependent DNA helicase 2 subunit 1 OS=Drosophila melanogaster OX=7227 GN=Irbp PE=2 SV=3
11	AFDB:Q9U2D2	0.681	0.615	3.078E-36	679	0.200	0.180	Q9U2D2.pdb.gz	Q9U2D2_CAEEL Ku domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cku-70 PE=1 SV=3
12	PDB:5y58A	0.644	0.710	3.427E-31	548	0.182	0.203	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
13	PDB:6zheC	0.526	0.466	1.745E-24	705	0.154	0.133	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
14	PDB:7k0yC	0.505	0.475	1.986E-22	655	0.159	0.148	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
15	PDB:5y58B	0.442	0.464	4.132E-22	568	0.151	0.162	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
16	PDB:7nfcC	0.481	0.584	1.536E-19	477	0.135	0.172	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
17	PDB:6sn1B	0.206	0.241	1.124E-9	503	0.113	0.137	6sn1B.pdb.gz
18	PDB:6sn1A	0.233	0.267	2.839E-6	517	0.097	0.114	6sn1A.pdb.gz
19	PDB:7zs96	0.246	0.375	9.812E-6	383	0.066	0.104	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
20	PDB:3jcoW	0.200	0.558	3.795E-5	197	0.041	0.127	3jcoW.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZSS0	0.0	935	615	0.749	0.741	A0A8I5ZSS0_RAT X-ray repair cross complementing 6 OS=Rattus norvegicus OX=10116 GN=Xrcc6 PE=1 SV=1
2	A0A8I5ZXI9	0.0	885	554	0.754	0.829	A0A8I5ZXI9_RAT X-ray repair cross complementing 6 OS=Rattus norvegicus OX=10116 GN=Xrcc6 PE=1 SV=1
3	B1AHC9	0.0	1118	559	0.893	0.973	B1AHC9_HUMAN X-ray repair cross complementing 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=1
4	E9PT85	0.0	1019	609	0.833	0.833	E9PT85_RAT X-ray repair cross complementing 6 OS=Rattus norvegicus OX=10116 GN=Xrcc6 PE=1 SV=1
5	F1QZ60	0.0	728	610	0.581	0.580	F1QZ60_DANRE X-ray repair cross-complementing protein 6 OS=Danio rerio OX=7955 GN=Ku70 PE=1 SV=1
6	F7EV16	0.0	1003	593	0.803	0.825	F7EV16_RAT X-ray repair cross complementing 6 OS=Rattus norvegicus OX=10116 GN=Xrcc6 PE=1 SV=1
7	O93257	0.0	897	632	0.700	0.674	XRCC6_CHICK X-ray repair cross-complementing protein 5 OS=Gallus gallus OX=9031 GN=XRCC6 PE=2 SV=1
8	P12956	0.0	1251	609	1.000	1.000	XRCC6_HUMAN X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2
9	P23475	0.0	1011	608	0.829	0.831	XRCC6_MOUSE X-ray repair cross-complementing protein 6 OS=Mus musculus OX=10090 GN=Xrcc6 PE=1 SV=5
10	Q6AZ64	0.0	1020	608	0.833	0.834	Q6AZ64_RAT X-ray repair complementing defective repair in Chinese hamster cells 6, isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Xrcc6 PE=2 SV=1
11	Q54MA9	2.18e-74	257	909	0.258	0.173	KU70_DICDI ATP-dependent DNA helicase ku70 OS=Dictyostelium discoideum OX=44689 GN=ku70 PE=3 SV=1
12	Q9FQ08	6.14e-72	245	621	0.323	0.317	KU70_ARATH ATP-dependent DNA helicase 2 subunit KU70 OS=Arabidopsis thaliana OX=3702 GN=KU70 PE=1 SV=1
13	Q7F1M0	9.14e-65	226	624	0.299	0.292	KU70_ORYSJ ATP-dependent DNA helicase 2 subunit KU70 OS=Oryza sativa subsp. japonica OX=39947 GN=KU70 PE=1 SV=1
14	O94395	8.06e-58	206	607	0.281	0.282	KU70_SCHPO ATP-dependent DNA helicase II subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pku70 PE=1 SV=1
15	Q23976	3.64e-37	149	631	0.240	0.231	KU70_DROME ATP-dependent DNA helicase 2 subunit 1 OS=Drosophila melanogaster OX=7227 GN=Irbp PE=2 SV=3
16	Q9U2D2	9.54e-20	95.9	679	0.240	0.215	Q9U2D2_CAEEL Ku domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cku-70 PE=1 SV=3
17	Q6FQX8	9.11e-11	67.0	606	0.192	0.193	Q6FQX8_CANGA ATP-dependent DNA helicase II subunit 1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=YKU70 PE=3 SV=1
18	Q582N4	4.89e-10	65.1	737	0.066	0.054	Q582N4_TRYB2 KU70 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.810 PE=4 SV=1
19	Q9FQ09	1.19e-09	63.5	680	0.195	0.175	KU80_ARATH ATP-dependent DNA helicase 2 subunit KU80 OS=Arabidopsis thaliana OX=3702 GN=KU80 PE=1 SV=1
20	P32807	1.40e-08	60.1	602	0.186	0.188	KU70_YEAST ATP-dependent DNA helicase II subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKU70 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02735 Ku	2.6e-47	172.7	Ku70/Ku80 beta-barrel domain
2	PF03730 Ku_C	7.2e-24	95.5	Ku70/Ku80 C-terminal arm
3	PF03731 Ku_N	8.7e-77	269.3	Ku70/Ku80 N-terminal alpha/beta domain
4	PF02037 SAP	4.6e-06	37.5	SAP domain
5	PF13867 SAP30_Sin3_bdg	32	16.2	Sin3 binding region of histone deacetylase complex subunit SAP30

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352257

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234420	0.999	DNA mismatch repair protein Msh6
2	9606.ENSP00000298139	0.999	Werner syndrome ATP-dependent helicase
3	9606.ENSP00000307004	0.999	Aprataxin and PNK-like factor
4	9606.ENSP00000313420	0.999	DNA-dependent protein kinase catalytic subunit
5	9606.ENSP00000375978	0.999	X-ray repair cross-complementing protein 5
6	9606.ENSP00000421491	0.999	DNA repair protein XRCC4
7	9606.ENSP00000484288	0.999	DNA ligase 4
8	9606.ENSP00000278616	0.998	Serine-protein kinase ATM
9	9606.ENSP00000349313	0.998	Non-homologous end-joining factor 1
10	9606.ENSP00000315130	0.997	Clusterin
11	9606.ENSP00000212015	0.996	NAD-dependent protein deacetylase sirtuin-1
12	9606.ENSP00000434024	0.995	Histone H2AX
13	9606.ENSP00000269305	0.994	Cellular tumor antigen p53
14	9606.ENSP00000309572	0.994	Telomerase reverse transcriptase
15	9606.ENSP00000325863	0.994	Double-strand break repair protein MRE11
16	9606.ENSP00000360682	0.993	Protein PAXX
17	9606.ENSP00000293288	0.991	Apoptosis regulator BAX
18	9606.ENSP00000355759	0.991	Poly [ADP-ribose] polymerase 1
19	9606.ENSP00000233146	0.990	DNA mismatch repair protein Msh2
20	9606.ENSP00000355506	0.989	Exonuclease 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0003690	0.996	double-stranded DNA binding
GO:0003824	0.914	catalytic activity
GO:0003723	0.852	RNA binding
GO:1990837	0.773	sequence-specific double-stranded DNA binding
GO:0003691	0.742	double-stranded telomeric DNA binding
GO:0044877	0.472	protein-containing complex binding
GO:0008094	0.451	ATP-dependent activity, acting on DNA
GO:0003678	0.437	DNA helicase activity
GO:0016787	0.314	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.997	macromolecule metabolic process
GO:0051716	0.996	cellular response to stimulus
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0010212	0.993	response to ionizing radiation
GO:0006259	0.989	DNA metabolic process
GO:0006974	0.986	cellular response to DNA damage stimulus
GO:0104004	0.984	cellular response to environmental stimulus
GO:0006281	0.984	DNA repair
GO:0071479	0.972	cellular response to ionizing radiation
GO:0006302	0.920	double-strand break repair
GO:0050794	0.909	regulation of cellular process
GO:0019222	0.860	regulation of metabolic process
GO:0080090	0.753	regulation of primary metabolic process
GO:0031323	0.752	regulation of cellular metabolic process
GO:0060255	0.738	regulation of macromolecule metabolic process
GO:0051171	0.681	regulation of nitrogen compound metabolic process
GO:0048518	0.638	positive regulation of biological process
GO:0019219	0.608	regulation of nucleobase-containing compound metabolic process
GO:0042221	0.589	response to chemical
GO:0048522	0.574	positive regulation of cellular process
GO:0071840	0.537	cellular component organization or biogenesis
GO:0016043	0.496	cellular component organization
GO:0032502	0.444	developmental process
GO:0010468	0.434	regulation of gene expression
GO:0009893	0.434	positive regulation of metabolic process
GO:0070887	0.428	cellular response to chemical stimulus
GO:0010604	0.415	positive regulation of macromolecule metabolic process
GO:0051173	0.414	positive regulation of nitrogen compound metabolic process
GO:0031325	0.409	positive regulation of cellular metabolic process
GO:0031326	0.408	regulation of cellular biosynthetic process
GO:0048856	0.406	anatomical structure development
GO:0010556	0.406	regulation of macromolecule biosynthetic process
GO:0032501	0.394	multicellular organismal process
GO:0007275	0.362	multicellular organism development
GO:0051252	0.357	regulation of RNA metabolic process
GO:0048519	0.330	negative regulation of biological process
GO:0045935	0.324	positive regulation of nucleobase-containing compound metabolic process
GO:0006996	0.315	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.977	cytoplasm
GO:0032991	0.965	protein-containing complex
GO:0043232	0.952	intracellular non-membrane-bounded organelle
GO:0005730	0.574	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.314	Hydrolases.

[back to server]