StarFunc result for job id P12980

User Input

>input (280 residues)
MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGV
PVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGP
FSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTH
PPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSG
RRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12980	1.000	1.000	1.754E-42	280	1.000	1.000	P12980.pdb.gz	LYL1_HUMAN Protein lyl-1 OS=Homo sapiens OX=9606 GN=LYL1 PE=1 SV=3
2	AFDB:P27792	0.597	0.600	1.458E-32	278	0.779	0.784	P27792.pdb.gz	LYL1_MOUSE Protein lyl-1 OS=Mus musculus OX=10090 GN=Lyl1 PE=2 SV=2
3	AFDB:P48985	0.289	0.238	1.474E-5	351	0.254	0.202	P48985.pdb.gz	ATOH1_MOUSE Transcription factor Atoh1 OS=Mus musculus OX=10090 GN=Atoh1 PE=1 SV=1
4	AFDB:Q6XD76	0.235	0.379	2.543E-5	172	0.186	0.302	Q6XD76.pdb.gz	ASCL4_HUMAN Achaete-scute homolog 4 OS=Homo sapiens OX=9606 GN=ASCL4 PE=1 SV=1
5	AFDB:Q92858	0.307	0.253	3.341E-5	354	0.250	0.198	Q92858.pdb.gz	ATOH1_HUMAN Transcription factor ATOH1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1
6	AFDB:P19360	0.266	0.285	5.764E-5	260	0.232	0.250	P19360.pdb.gz	ASCL2_RAT Achaete-scute homolog 2 OS=Rattus norvegicus OX=10116 GN=Ascl2 PE=1 SV=1
7	AFDB:M0QWB7	0.219	0.308	1.065E-4	188	0.186	0.277	M0QWB7.pdb.gz	ASCL5_MOUSE Achaete-scute homolog 5 OS=Mus musculus OX=10090 GN=Ascl5 PE=1 SV=1
8	AFDB:Q8GZ38	0.196	0.141	1.140E-4	399	0.175	0.123	Q8GZ38.pdb.gz	UNE10_ARATH Transcription factor UNE10 OS=Arabidopsis thaliana OX=3702 GN=UNE10 PE=1 SV=1
9	AFDB:E7F361	0.235	0.326	1.837E-4	200	0.168	0.235	E7F361.pdb.gz
10	AFDB:O16867	0.232	0.166	1.837E-4	398	0.229	0.161	O16867.pdb.gz	TAP_DROME Basic helix-loop-helix neural transcription factor TAP OS=Drosophila melanogaster OX=7227 GN=tap PE=1 SV=2
11	PDB:3ojaA	0.197	0.122	1.334	482	0.046	0.027	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:6lo8E	0.133	0.363	2.150	80	0.057	0.200	6lo8E.pdb.gz
13	PDB:6zx9C	0.096	0.102	2.825	257	0.064	0.070	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
14	PDB:6hivCN	0.116	0.176	3.237	157	0.046	0.083	6hivCN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:7ungA0	0.135	0.169	4.252	220	0.039	0.050	7ungA0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:7ktrE	0.108	0.203	4.874	124	0.061	0.137	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
17	PDB:7rroA0	0.120	0.149	4.874	221	0.036	0.045	7rroA0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:7rro2	0.075	0.072	5.218	292	0.057	0.055	7rro2.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:6v8oO	0.081	0.063	6.853	384	0.100	0.073	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
20	PDB:3jb9M	0.102	0.137	7.337	207	0.054	0.072	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12980	0.0	550	280	1.000	1.000	LYL1_HUMAN Protein lyl-1 OS=Homo sapiens OX=9606 GN=LYL1 PE=1 SV=3
2	P27792	8.43e-141	399	278	0.779	0.784	LYL1_MOUSE Protein lyl-1 OS=Mus musculus OX=10090 GN=Lyl1 PE=2 SV=2
3	O93507	2.88e-43	152	324	0.243	0.210	TAL1_DANRE T-cell acute lymphocytic leukemia protein 1 homolog OS=Danio rerio OX=7955 GN=tal1 PE=1 SV=1
4	O73823	1.43e-39	144	394	0.250	0.178	TAL1_XENLA T-cell acute lymphocytic leukemia protein 1 OS=Xenopus laevis OX=8355 GN=tal1 PE=2 SV=1
5	P17542	7.60e-38	137	331	0.250	0.211	TAL1_HUMAN T-cell acute lymphocytic leukemia protein 1 OS=Homo sapiens OX=9606 GN=TAL1 PE=1 SV=2
6	P22091	1.30e-37	137	329	0.250	0.213	TAL1_MOUSE T-cell acute lymphocytic leukemia protein 1 homolog OS=Mus musculus OX=10090 GN=Tal1 PE=1 SV=1
7	F1QUD8	1.23e-28	107	109	0.164	0.422	F1QUD8_DANRE T-cell acute lymphocytic leukemia 2 OS=Danio rerio OX=7955 GN=zgc:111884 PE=4 SV=1
8	Q16559	2.84e-28	106	108	0.161	0.417	TAL2_HUMAN T-cell acute lymphocytic leukemia protein 2 OS=Homo sapiens OX=9606 GN=TAL2 PE=1 SV=1
9	Q62282	2.24e-27	104	108	0.157	0.407	TAL2_MOUSE T-cell acute lymphocytic leukemia protein 2 homolog OS=Mus musculus OX=10090 GN=Tal2 PE=4 SV=1
10	Q02577	4.34e-13	67.0	135	0.114	0.237	HEN2_HUMAN Helix-loop-helix protein 2 OS=Homo sapiens OX=9606 GN=NHLH2 PE=1 SV=1
11	Q64221	4.48e-13	67.0	135	0.114	0.237	HEN2_MOUSE Helix-loop-helix protein 2 OS=Mus musculus OX=10090 GN=Nhlh2 PE=1 SV=2
12	Q02575	8.86e-13	66.2	133	0.114	0.241	HEN1_HUMAN Helix-loop-helix protein 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
13	Q5T203	8.86e-13	66.2	133	0.114	0.241	Q5T203_HUMAN Nescient helix loop helix 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
14	Q60756	1.86e-11	63.9	195	0.118	0.169	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
15	Q9PVG4	2.03e-11	63.9	190	0.111	0.163	Q9PVG4_CHICK CTwist OS=Gallus gallus OX=9031 GN=TWIST1 PE=2 SV=1
16	Q568M7	2.09e-11	63.2	169	0.111	0.183	Q568M7_DANRE Twist family bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=twist1a PE=2 SV=1
17	Q9EPJ1	2.52e-11	63.9	203	0.111	0.153	Q9EPJ1_RAT Twist-related protein 1 OS=Rattus norvegicus OX=10116 GN=Twist1 PE=1 SV=1
18	Q9PTE3	2.54e-11	63.2	171	0.111	0.181	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1
19	P26687	2.64e-11	63.9	206	0.111	0.150	TWST1_MOUSE Twist-related protein 1 OS=Mus musculus OX=10090 GN=Twist1 PE=1 SV=1
20	Q15672	2.69e-11	63.5	202	0.111	0.153	TWST1_HUMAN Twist-related protein 1 OS=Homo sapiens OX=9606 GN=TWIST1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	2.4e-12	58.0	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262965	0.996	Transcription factor E2-alpha
2	9606.ENSP00000257818	0.972	Rhombotin-2
3	9606.ENSP00000365280	0.928	DNA-binding protein inhibitor ID-1
4	9606.ENSP00000363689	0.918	DNA-binding protein inhibitor ID-3
5	9606.ENSP00000263253	0.831	Histone acetyltransferase p300
6	9606.ENSP00000345681	0.785	Endothelial transcription factor GATA-2
7	9606.ENSP00000338207	0.775	Rhombotin-1
8	9606.ENSP00000387699	0.774	Cyclic AMP-responsive element-binding protein 1
9	9606.ENSP00000359215	0.730	T-cell leukemia homeobox protein 1
10	9606.ENSP00000392466	0.697	LIM domain-binding protein 1
11	9606.ENSP00000296921	0.693	T-cell leukemia homeobox protein 3
12	9606.ENSP00000359357	0.692	Zinc finger protein Gfi-1
13	9606.ENSP00000344782	0.691	Zinc finger protein Gfi-1b
14	9606.ENSP00000227163	0.669	Transcription factor PU.1
15	9606.ENSP00000306772	0.641	LIM domain-binding protein 2
16	9606.ENSP00000282728	0.635	Hematopoietically-expressed homeobox protein HHEX
17	9606.ENSP00000268679	0.630	Protein CBFA2T3
18	9606.ENSP00000427975	0.630	Ran-binding protein 17
19	9606.ENSP00000388940	0.625	Transcription factor 12
20	9606.ENSP00000365858	0.624	Erythroid transcription factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0043565	0.967	sequence-specific DNA binding
GO:0003690	0.952	double-stranded DNA binding
GO:1990837	0.938	sequence-specific double-stranded DNA binding
GO:0000976	0.910	transcription cis-regulatory region binding
GO:0140110	0.887	transcription regulator activity
GO:0003700	0.876	DNA-binding transcription factor activity
GO:0000977	0.697	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.493	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.307	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0048518	0.984	positive regulation of biological process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0009889	0.981	regulation of biosynthetic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0048856	0.975	anatomical structure development
GO:0048522	0.972	positive regulation of cellular process
GO:0010468	0.959	regulation of gene expression
GO:0032501	0.952	multicellular organismal process
GO:0019219	0.950	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.935	regulation of DNA-templated transcription
GO:0009987	0.927	cellular process
GO:0010604	0.925	positive regulation of macromolecule metabolic process
GO:0007275	0.892	multicellular organism development
GO:0031325	0.869	positive regulation of cellular metabolic process
GO:0051173	0.863	positive regulation of nitrogen compound metabolic process
GO:0045893	0.796	positive regulation of DNA-templated transcription
GO:0048731	0.776	system development
GO:0006357	0.770	regulation of transcription by RNA polymerase II
GO:0048519	0.444	negative regulation of biological process
GO:0030154	0.444	cell differentiation
GO:0048523	0.426	negative regulation of cellular process
GO:0045944	0.356	positive regulation of transcription by RNA polymerase II
GO:0009892	0.330	negative regulation of metabolic process
GO:0010605	0.313	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.884	protein-containing complex
GO:0005737	0.524	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]