StarFunc result for job id P13010

User Input

>input (732 residues)
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFG
TDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQH
ETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGD
GPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDD
DETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQ
VLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLV
YVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLI
EAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRV
LVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLK
ALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFE
EGGDVDDLLDMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V817	0.726	0.726	0.000	732	0.784	0.784	G3V817.pdb.gz	G3V817_RAT X-ray repair cross-complementing protein 5 OS=Rattus norvegicus OX=10116 GN=Xrcc5 PE=3 SV=1
2	AFDB:P13010	1.000	1.000	0.000	732	1.000	1.000	P13010.pdb.gz	XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3
3	AFDB:A0A0R4IB13	0.712	0.717	1.580E-98	727	0.568	0.572	A0A0R4IB13.pdb.gz	A0A0R4IB13_DANRE X-ray repair cross-complementing protein 5 OS=Danio rerio OX=7955 GN=Ku80 PE=1 SV=1
4	PDB:6zheC	0.696	0.722	3.174E-93	705	0.962	0.999	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
5	PDB:7k0yC	0.692	0.771	2.216E-90	655	0.881	0.985	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
6	PDB:7nfcC	0.566	0.834	3.734E-67	477	0.650	0.998	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
7	AFDB:Q54LY5	0.584	0.541	1.623E-54	796	0.303	0.279	Q54LY5.pdb.gz	XRCC5_DICDI X-ray repair cross-complementing protein 5 OS=Dictyostelium discoideum OX=44689 GN=ku80 PE=3 SV=1
8	AFDB:Q75IP6	0.592	0.626	2.002E-48	688	0.223	0.237	Q75IP6.pdb.gz	KU80_ORYSJ ATP-dependent DNA helicase 2 subunit KU80 OS=Oryza sativa subsp. japonica OX=39947 GN=KU80 PE=1 SV=1
9	AFDB:Q4WI96	0.527	0.531	8.645E-47	725	0.216	0.218	Q4WI96.pdb.gz	KU80_ASPFU ATP-dependent DNA helicase II subunit 2 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ku80 PE=3 SV=1
10	AFDB:Q9FQ09	0.577	0.617	1.492E-46	680	0.228	0.246	Q9FQ09.pdb.gz	KU80_ARATH ATP-dependent DNA helicase 2 subunit KU80 OS=Arabidopsis thaliana OX=3702 GN=KU80 PE=1 SV=1
11	AFDB:Q9HGM8	0.540	0.564	4.499E-42	695	0.205	0.216	Q9HGM8.pdb.gz	KU80_SCHPO ATP-dependent DNA helicase II subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pku80 PE=1 SV=1
12	AFDB:Q8MSM8	0.632	0.660	3.579E-41	699	0.191	0.200	Q8MSM8.pdb.gz	Q8MSM8_DROME ATP-dependent DNA helicase II subunit 2 OS=Drosophila melanogaster OX=7227 GN=Ku80 PE=2 SV=1
13	AFDB:Q21829	0.607	0.622	6.455E-40	713	0.175	0.180	Q21829.pdb.gz	Q21829_CAEEL ATP-dependent DNA helicase II subunit 2 OS=Caenorhabditis elegans OX=6239 GN=cku-80 PE=1 SV=2
14	PDB:1jeqA	0.453	0.575	4.616E-25	548	0.120	0.161	1jeqA.pdb.gz
15	PDB:5y58B	0.444	0.547	1.675E-22	568	0.134	0.173	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
16	PDB:5y58A	0.389	0.488	1.868E-22	548	0.112	0.150	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
17	PDB:6sn1B	0.211	0.297	1.086E-12	503	0.096	0.139	6sn1B.pdb.gz
18	PDB:4nehA	0.213	0.148	1.760E-6	1084	0.061	0.042	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
19	PDB:6jp8F	0.172	0.134	1.963E-6	973	0.078	0.059	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
20	PDB:7pksf	0.198	0.258	3.990E-6	536	0.078	0.106	7pksf.pdb.gz	Structural basis of Integrator-mediated transcription regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IB13	0.0	810	727	0.567	0.571	A0A0R4IB13_DANRE X-ray repair cross-complementing protein 5 OS=Danio rerio OX=7955 GN=Ku80 PE=1 SV=1
2	G3V817	0.0	1173	732	0.784	0.784	G3V817_RAT X-ray repair cross-complementing protein 5 OS=Rattus norvegicus OX=10116 GN=Xrcc5 PE=3 SV=1
3	P13010	0.0	1511	732	1.000	1.000	XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3
4	P27641	0.0	1174	732	0.784	0.784	XRCC5_MOUSE X-ray repair cross-complementing protein 5 OS=Mus musculus OX=10090 GN=Xrcc5 PE=1 SV=4
5	Q6P7P8	0.0	1167	732	0.783	0.783	Q6P7P8_RAT X-ray repair cross-complementing protein 5 OS=Rattus norvegicus OX=10116 GN=Xrcc5 PE=2 SV=1
6	Q54LY5	2.54e-69	244	796	0.224	0.206	XRCC5_DICDI X-ray repair cross-complementing protein 5 OS=Dictyostelium discoideum OX=44689 GN=ku80 PE=3 SV=1
7	Q75IP6	6.04e-43	167	688	0.245	0.260	KU80_ORYSJ ATP-dependent DNA helicase 2 subunit KU80 OS=Oryza sativa subsp. japonica OX=39947 GN=KU80 PE=1 SV=1
8	Q4WI96	1.10e-33	140	725	0.149	0.150	KU80_ASPFU ATP-dependent DNA helicase II subunit 2 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ku80 PE=3 SV=1
9	Q9FQ09	3.12e-33	138	680	0.156	0.168	KU80_ARATH ATP-dependent DNA helicase 2 subunit KU80 OS=Arabidopsis thaliana OX=3702 GN=KU80 PE=1 SV=1
10	Q9NGX6	4.46e-17	87.8	699	0.219	0.229	Q9NGX6_DROME ATP-dependent DNA helicase II subunit 2 OS=Drosophila melanogaster OX=7227 GN=Ku80 PE=2 SV=1
11	Q8MSM8	7.44e-17	87.4	699	0.219	0.229	Q8MSM8_DROME ATP-dependent DNA helicase II subunit 2 OS=Drosophila melanogaster OX=7227 GN=Ku80 PE=2 SV=1
12	Q9I7M8	1.08e-16	86.7	699	0.217	0.227	Q9I7M8_DROME ATP-dependent DNA helicase II subunit 2 OS=Drosophila melanogaster OX=7227 GN=Ku80 PE=1 SV=1
13	Q9HGM8	2.40e-16	85.5	695	0.126	0.132	KU80_SCHPO ATP-dependent DNA helicase II subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pku80 PE=1 SV=1
14	Q21829	2.89e-10	66.2	713	0.160	0.164	Q21829_CAEEL ATP-dependent DNA helicase II subunit 2 OS=Caenorhabditis elegans OX=6239 GN=cku-80 PE=1 SV=2
15	Q6FN20	7.90e-07	55.1	615	0.057	0.068	Q6FN20_CANGA ATP-dependent DNA helicase II subunit 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=YKU80 PE=3 SV=1
16	Q585N5	0.002	43.9	635	0.030	0.035	Q585N5_TRYB2 KU80 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.670 PE=3 SV=1
17	Q04437	0.23	37.4	629	0.048	0.056	KU80_YEAST ATP-dependent DNA helicase II subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKU80 PE=1 SV=1
18	Q04089	1.8	34.3	582	0.029	0.036	DOT1_YEAST Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOT1 PE=1 SV=1
19	Q7F1M0	1.9	34.3	624	0.060	0.071	KU70_ORYSJ ATP-dependent DNA helicase 2 subunit KU70 OS=Oryza sativa subsp. japonica OX=39947 GN=KU70 PE=1 SV=1
20	B7Z0H1	4.9	32.7	567	0.027	0.035	B7Z0H1_DROME P130CAS, isoform E OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12125 Beta-TrCP_D	1.1e+02	14.3	D domain of beta-TrCP
2	PF19468 DUF6005	1e+02	13.3	Family of unknown function (DUF6005)
3	PF02735 Ku	4.4e-40	149.1	Ku70/Ku80 beta-barrel domain
4	PF03730 Ku_C	2.9e-15	68.0	Ku70/Ku80 C-terminal arm
5	PF03731 Ku_N	2.2e-61	218.9	Ku70/Ku80 N-terminal alpha/beta domain
6	PF08785 Ku_PK_bind	8.9e-27	105.0	Ku C terminal domain like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307004	0.999	Aprataxin and PNK-like factor
2	9606.ENSP00000313420	0.999	DNA-dependent protein kinase catalytic subunit
3	9606.ENSP00000349313	0.999	Non-homologous end-joining factor 1
4	9606.ENSP00000352257	0.999	X-ray repair cross-complementing protein 6
5	9606.ENSP00000421491	0.998	DNA repair protein XRCC4
6	9606.ENSP00000484288	0.998	DNA ligase 4
7	9606.ENSP00000278616	0.997	Serine-protein kinase ATM
8	9606.ENSP00000298139	0.996	Werner syndrome ATP-dependent helicase
9	9606.ENSP00000418960	0.995	Breast cancer type 1 susceptibility protein
10	9606.ENSP00000309572	0.994	Telomerase reverse transcriptase
11	9606.ENSP00000325863	0.993	Double-strand break repair protein MRE11
12	9606.ENSP00000355759	0.992	Poly [ADP-ribose] polymerase 1
13	9606.ENSP00000233146	0.983	DNA mismatch repair protein Msh2
14	9606.ENSP00000276603	0.983	Telomeric repeat-binding factor 1
15	9606.ENSP00000367527	0.983	Protein artemis
16	9606.ENSP00000013807	0.979	DNA excision repair protein ERCC-1
17	9606.ENSP00000323511	0.979	Bifunctional polynucleotide phosphatase/kinase
18	9606.ENSP00000234420	0.978	DNA mismatch repair protein Msh6
19	9606.ENSP00000360216	0.977	DNA nucleotidylexotransferase
20	9606.ENSP00000269305	0.976	Cellular tumor antigen p53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0003690	0.996	double-stranded DNA binding
GO:0043565	0.924	sequence-specific DNA binding
GO:0003723	0.918	RNA binding
GO:1990837	0.730	sequence-specific double-stranded DNA binding
GO:0003824	0.648	catalytic activity
GO:0042162	0.638	telomeric DNA binding
GO:0140097	0.601	catalytic activity, acting on DNA
GO:0045027	0.595	DNA end binding
GO:0008094	0.594	ATP-dependent activity, acting on DNA
GO:0003691	0.591	double-stranded telomeric DNA binding
GO:0004386	0.575	helicase activity
GO:0044877	0.551	protein-containing complex binding
GO:0016787	0.547	hydrolase activity
GO:0051575	0.503	5'-deoxyribose-5-phosphate lyase activity
GO:0016887	0.492	ATP hydrolysis activity
GO:0003678	0.464	DNA helicase activity
GO:0000976	0.420	transcription cis-regulatory region binding
GO:0019899	0.408	enzyme binding
GO:0034511	0.393	U3 snoRNA binding
GO:0030234	0.385	enzyme regulator activity
GO:0140677	0.379	molecular function activator activity
GO:0031625	0.301	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.991	response to stimulus
GO:0051716	0.978	cellular response to stimulus
GO:0050789	0.971	regulation of biological process
GO:0050794	0.957	regulation of cellular process
GO:0006950	0.937	response to stress
GO:0010212	0.924	response to ionizing radiation
GO:0006974	0.916	cellular response to DNA damage stimulus
GO:0032501	0.889	multicellular organismal process
GO:0071704	0.889	organic substance metabolic process
GO:0044237	0.878	cellular metabolic process
GO:0044238	0.877	primary metabolic process
GO:0006807	0.860	nitrogen compound metabolic process
GO:0032502	0.849	developmental process
GO:0043170	0.842	macromolecule metabolic process
GO:0104004	0.829	cellular response to environmental stimulus
GO:0048519	0.826	negative regulation of biological process
GO:0048523	0.822	negative regulation of cellular process
GO:0006259	0.788	DNA metabolic process
GO:0071478	0.777	cellular response to radiation
GO:0006281	0.770	DNA repair
GO:0071479	0.759	cellular response to ionizing radiation
GO:0042221	0.757	response to chemical
GO:0048856	0.746	anatomical structure development
GO:0071470	0.744	cellular response to osmotic stress
GO:0042538	0.729	hyperosmotic salinity response
GO:0071474	0.676	cellular hyperosmotic response
GO:0071472	0.676	cellular response to salt stress
GO:0070542	0.646	response to fatty acid
GO:0019222	0.627	regulation of metabolic process
GO:0007275	0.626	multicellular organism development
GO:0060255	0.597	regulation of macromolecule metabolic process
GO:0080090	0.586	regulation of primary metabolic process
GO:0051171	0.586	regulation of nitrogen compound metabolic process
GO:0031323	0.512	regulation of cellular metabolic process
GO:0006302	0.512	double-strand break repair
GO:0007399	0.509	nervous system development
GO:0048518	0.478	positive regulation of biological process
GO:0071840	0.477	cellular component organization or biogenesis
GO:0019219	0.453	regulation of nucleobase-containing compound metabolic process
GO:0016043	0.444	cellular component organization
GO:0048522	0.386	positive regulation of cellular process
GO:0009892	0.385	negative regulation of metabolic process
GO:0071310	0.378	cellular response to organic substance
GO:0010604	0.339	positive regulation of macromolecule metabolic process
GO:0051173	0.336	positive regulation of nitrogen compound metabolic process
GO:0010556	0.316	regulation of macromolecule biosynthetic process
GO:0031326	0.316	regulation of cellular biosynthetic process
GO:0031325	0.316	positive regulation of cellular metabolic process
GO:0010468	0.304	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0140513	0.995	nuclear protein-containing complex
GO:1990391	0.988	DNA repair complex
GO:0140535	0.985	intracellular protein-containing complex
GO:0005654	0.981	nucleoplasm
GO:0043232	0.952	intracellular non-membrane-bounded organelle
GO:0070419	0.697	nonhomologous end joining complex
GO:0005694	0.675	chromosome
GO:0012505	0.562	endomembrane system
GO:0098687	0.557	chromosomal region
GO:0005886	0.538	plasma membrane
GO:0005829	0.517	cytosol
GO:1902911	0.475	protein kinase complex
GO:1902554	0.474	serine/threonine protein kinase complex
GO:0031410	0.458	cytoplasmic vesicle
GO:0060205	0.426	cytoplasmic vesicle lumen
GO:0090734	0.419	site of DNA damage
GO:0030684	0.416	preribosome
GO:0034774	0.416	secretory granule lumen
GO:0032040	0.414	small-subunit processome
GO:0043564	0.405	Ku70:Ku80 complex
GO:0070418	0.399	DNA-dependent protein kinase complex
GO:0005576	0.382	extracellular region
GO:0005730	0.373	nucleolus
GO:0032993	0.350	protein-DNA complex
GO:0044815	0.341	DNA packaging complex
GO:0000783	0.322	nuclear telomere cap complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.547	Hydrolases.
EC:4.2.-.-	0.503	Carbon-oxygen lyases.
RHEA:13065	0.492	ATP + H2O = ADP + H(+) + phosphate

[back to server]