StarFunc result for job id P13056

User Input

>input (603 residues)
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKVFDLCVVCGDKA
SGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQ
DSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSESTRSTGLLDSGM
FMNIHPSGVKTESAVLMTSDKAESCQGDLSTLANVVTSLANLGKTKDLSQNSNEMSMIES
LSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSIN
YTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQE
NSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIF
KLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPSLENMEQIEKFQEKAYVEFQDYITKTY
PDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIG
HSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13056	1.000	1.000	1.821E-86	603	1.000	1.000	P13056.pdb.gz	NR2C1_HUMAN Nuclear receptor subfamily 2 group C member 1 OS=Homo sapiens OX=9606 GN=NR2C1 PE=1 SV=2
2	AFDB:Q26622	0.519	0.535	1.669E-45	583	0.474	0.491	Q26622.pdb.gz	SHR2_STRPU Orphan steroid hormone receptor 2 OS=Strongylocentrotus purpuratus OX=7668 GN=SHR2 PE=1 SV=1
3	AFDB:Q24142	0.376	0.377	7.951E-26	601	0.250	0.251	Q24142.pdb.gz	HR78_DROME Nuclear hormone receptor HR78 OS=Drosophila melanogaster OX=7227 GN=Hr78 PE=1 SV=2
4	AFDB:F1D8R0	0.330	0.450	1.422E-22	414	0.235	0.343	F1D8R0.pdb.gz	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
5	AFDB:B3DGQ7	0.318	0.439	1.490E-22	428	0.240	0.339	B3DGQ7.pdb.gz
6	AFDB:P10589	0.359	0.484	3.152E-22	423	0.240	0.343	P10589.pdb.gz	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
7	AFDB:A1ZA01	0.397	0.410	5.792E-22	582	0.250	0.259	A1ZA01.pdb.gz	A1ZA01_DROME Hormone receptor 51 OS=Drosophila melanogaster OX=7227 GN=Hr51 PE=2 SV=2
8	AFDB:P10588	0.333	0.460	6.070E-22	404	0.237	0.354	P10588.pdb.gz	NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens OX=9606 GN=NR2F6 PE=1 SV=2
9	AFDB:B3DKN2	0.280	0.311	7.399E-18	537	0.197	0.222	B3DKN2.pdb.gz	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
10	AFDB:P20153	0.291	0.334	3.013E-17	508	0.209	0.248	P20153.pdb.gz	USP_DROME Protein ultraspiracle OS=Drosophila melanogaster OX=7227 GN=usp PE=1 SV=1
11	PDB:3dzyA	0.279	0.477	5.532E-14	302	0.186	0.371	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:1g2nA	0.252	0.569	4.958E-7	246	0.096	0.236	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.252	0.601	1.376E-5	238	0.071	0.181	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.218	0.455	6.390E-4	259	0.060	0.139	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7p5cA	0.078	0.111	1.758E-1	392	0.065	0.099	7p5cA.pdb.gz
16	PDB:5iztA	0.114	0.224	2.679E-1	211	0.033	0.095	5iztA.pdb.gz
17	PDB:7p5jA	0.076	0.101	3.717E-1	399	0.051	0.078	7p5jA.pdb.gz
18	PDB:7p54A	0.064	0.088	4.922E-1	397	0.050	0.076	7p54A.pdb.gz
19	PDB:4im0A	0.054	0.053	5.406E-1	619	0.066	0.065	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
20	PDB:6o8cA	0.070	0.067	5.936E-1	636	0.045	0.042	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2YGU2	0.0	743	615	0.625	0.613	F2YGU2_HUMAN Nuclear receptor subfamily 2, group C, member 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=NR2C2 PE=2 SV=1
2	P13056	0.0	1264	603	1.000	1.000	NR2C1_HUMAN Nuclear receptor subfamily 2 group C member 1 OS=Homo sapiens OX=9606 GN=NR2C1 PE=1 SV=2
3	P49116	0.0	743	596	0.627	0.634	NR2C2_HUMAN Nuclear receptor subfamily 2 group C member 2 OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1
4	P49117	0.0	742	596	0.625	0.633	NR2C2_MOUSE Nuclear receptor subfamily 2 group C member 2 OS=Mus musculus OX=10090 GN=Nr2c2 PE=1 SV=1
5	Q505F1	0.0	1071	590	0.876	0.895	NR2C1_MOUSE Nuclear receptor subfamily 2 group C member 1 OS=Mus musculus OX=10090 GN=Nr2c1 PE=1 SV=3
6	Q6PHZ7	0.0	598	530	0.516	0.587	Q6PHZ7_HUMAN NR2C2 protein OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1
7	Q26622	3.75e-180	523	583	0.493	0.509	SHR2_STRPU Orphan steroid hormone receptor 2 OS=Strongylocentrotus purpuratus OX=7668 GN=SHR2 PE=1 SV=1
8	Q24142	1.96e-37	149	601	0.104	0.105	HR78_DROME Nuclear hormone receptor HR78 OS=Drosophila melanogaster OX=7227 GN=Hr78 PE=1 SV=2
9	F1DAL9	1.29e-35	140	398	0.124	0.188	F1DAL9_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
10	A0A8I6A7N1	1.31e-35	140	398	0.124	0.188	A0A8I6A7N1_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
11	A0A1W2Q6N8	1.44e-35	137	273	0.124	0.275	A0A1W2Q6N8_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=4 SV=1
12	Q60632	1.57e-35	140	422	0.124	0.178	COT1_MOUSE COUP transcription factor 1 OS=Mus musculus OX=10090 GN=Nr2f1 PE=2 SV=2
13	P10589	1.69e-35	140	423	0.124	0.177	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
14	P28701	1.74e-35	141	467	0.106	0.137	RXRG_CHICK Retinoic acid receptor RXR-gamma OS=Gallus gallus OX=9031 GN=RXRG PE=2 SV=1
15	F1DAL7	1.85e-35	139	372	0.124	0.202	F1DAL7_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
16	F2Z3S9	2.03e-35	140	420	0.124	0.179	F2Z3S9_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
17	P16375	2.25e-35	142	543	0.144	0.160	7UP1_DROME Steroid receptor seven-up, isoforms B/C OS=Drosophila melanogaster OX=7227 GN=svp PE=1 SV=1
18	Q06725	2.77e-35	139	411	0.123	0.180	N2F1A_DANRE Nuclear receptor subfamily 2 group F member 1-A OS=Danio rerio OX=7955 GN=nr2f1a PE=2 SV=1
19	P51129	2.89e-35	140	470	0.104	0.134	RXRG_XENLA Retinoic acid receptor RXR-gamma OS=Xenopus laevis OX=8355 GN=rxrg PE=2 SV=1
20	A0A060YH15	3.37e-35	139	391	0.123	0.189	A0A060YH15_ONCMY COUP transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037055001 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10080 FtrD-like	67	15.0	Membrane iron-sulfur containing protein FtrD-like
2	PF00104 Hormone_recep	6.2e-34	129.0	Ligand-binding domain of nuclear hormone receptor
3	PF00105 zf-C4	4.9e-28	108.7	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333275

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302967	0.986	Histone deacetylase 3
2	9606.ENSP00000383063	0.969	Nuclear receptor-interacting protein 1
3	9606.ENSP00000348056	0.933	SUMO-conjugating enzyme UBC9
4	9606.ENSP00000249636	0.926	E3 SUMO-protein ligase PIAS1
5	9606.ENSP00000376077	0.869	Small ubiquitin-related modifier 1
6	9606.ENSP00000264606	0.709	Histone deacetylase 4
7	9606.ENSP00000366902	0.705	Telomere zinc finger-associated protein
8	9606.ENSP00000483059	0.688	Nuclear receptor subfamily 2 group C member 2
9	9606.ENSP00000368761	0.686	Zinc finger protein 827
10	9606.ENSP00000358576	0.662	5' exonuclease Apollo
11	9606.ENSP00000263754	0.655	Histone acetyltransferase KAT2B
12	9606.ENSP00000362170	0.645	Nuclear apoptosis-inducing factor 1
13	9606.ENSP00000349689	0.628	Palmitoyltransferase ZDHHC9
14	9606.ENSP00000231656	0.615	Homeobox protein CDX-1
15	9606.ENSP00000311453	0.615	High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
16	9606.ENSP00000415836	0.601	Zinc finger protein 276
17	9606.ENSP00000268058	0.595	Protein PML
18	9606.ENSP00000462337	0.591	Vascular endothelial zinc finger 1
19	9606.ENSP00000253024	0.578	Transcription intermediary factor 1-beta
20	9606.ENSP00000309653	0.569	Zinc finger protein GLIS1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.991	transcription regulator activity
GO:0003707	0.988	nuclear steroid receptor activity
GO:0003700	0.945	DNA-binding transcription factor activity
GO:0000976	0.792	transcription cis-regulatory region binding
GO:0000981	0.728	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.549	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.354	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.303	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.998	regulation of DNA-templated transcription
GO:0006357	0.943	regulation of transcription by RNA polymerase II
GO:0048523	0.936	negative regulation of cellular process
GO:0010558	0.909	negative regulation of macromolecule biosynthetic process
GO:0031327	0.909	negative regulation of cellular biosynthetic process
GO:0051253	0.905	negative regulation of RNA metabolic process
GO:0045892	0.890	negative regulation of DNA-templated transcription
GO:0000122	0.864	negative regulation of transcription by RNA polymerase II
GO:0048518	0.777	positive regulation of biological process
GO:0009987	0.652	cellular process
GO:0048522	0.568	positive regulation of cellular process
GO:0009893	0.447	positive regulation of metabolic process
GO:0010604	0.442	positive regulation of macromolecule metabolic process
GO:0051173	0.424	positive regulation of nitrogen compound metabolic process
GO:0031325	0.349	positive regulation of cellular metabolic process
GO:0045935	0.315	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.306	positive regulation of macromolecule biosynthetic process
GO:0031328	0.306	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.735	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]