StarFunc result for job id P13073

User Input

>input (169 residues)
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW
QKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13073	1.000	1.000	9.298E-30	169	1.000	1.000	P13073.pdb.gz	COX41_HUMAN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
2	AFDB:P00423	0.958	0.958	2.513E-25	169	0.828	0.828	P00423.pdb.gz	COX41_BOVIN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Bos taurus OX=9913 GN=COX4I1 PE=1 SV=1
3	AFDB:P10888	0.939	0.939	5.594E-25	169	0.799	0.799	P10888.pdb.gz	COX41_RAT Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox4i1 PE=1 SV=1
4	AFDB:Q4VBT9	0.880	0.880	1.370E-21	169	0.633	0.633	Q4VBT9.pdb.gz
5	PDB:2y69D	0.834	0.976	8.385E-21	144	0.698	0.819	2y69D.pdb.gz	A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
6	AFDB:Q96KJ9	0.780	0.771	6.517E-16	171	0.479	0.474	Q96KJ9.pdb.gz	COX42_HUMAN Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I2 PE=1 SV=2
7	AFDB:Q91W29	0.694	0.683	8.218E-15	172	0.473	0.465	Q91W29.pdb.gz	COX42_MOUSE Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i2 PE=1 SV=1
8	AFDB:Q9VIQ8	0.738	0.689	1.541E-11	182	0.331	0.308	Q9VIQ8.pdb.gz	Q9VIQ8_DROME Cytochrome c oxidase subunit 4 OS=Drosophila melanogaster OX=7227 GN=COX4 PE=1 SV=1
9	AFDB:Q9U329	0.723	0.700	4.179E-9	175	0.243	0.234	Q9U329.pdb.gz	Q9U329_CAEEL Cytochrome c oxidase subunit 4 OS=Caenorhabditis elegans OX=6239 GN=cox-4 PE=1 SV=1
10	AFDB:O74988	0.355	0.329	5.597E-4	186	0.237	0.215	O74988.pdb.gz	COX5_SCHPO Cytochrome c oxidase polypeptide 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox5 PE=1 SV=2
11	AFDB:Q5APK5	0.399	0.405	2.052E-2	165	0.166	0.170	Q5APK5.pdb.gz	Q5APK5_CANAL Cytochrome c oxidase subunit Va OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX5 PE=4 SV=1
12	PDB:7n8oB	0.169	0.062	3.298	503	0.101	0.034	7n8oB.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
13	PDB:7apxA	0.129	0.031	3.525	1165	0.118	0.017	7apxA.pdb.gz
14	PDB:7ouiB	0.151	0.065	4.028	487	0.083	0.029	7ouiB.pdb.gz	High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.
15	PDB:7ob9M	0.112	0.068	6.425	388	0.154	0.067	7ob9M.pdb.gz	Cryo-EM structures of human RNA polymerase I.
16	PDB:5dgeSM	0.164	0.173	6.868	159	0.095	0.101	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
17	PDB:7dvq7	0.108	0.222	6.868	81	0.030	0.062	7dvq7.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:6ahd9	0.160	0.163	8.389	165	0.077	0.079	6ahd9.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13073	3.44e-125	350	169	1.000	1.000	COX41_HUMAN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
2	P00423	6.07e-108	306	169	0.828	0.828	COX41_BOVIN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Bos taurus OX=9913 GN=COX4I1 PE=1 SV=1
3	P10888	3.85e-103	295	169	0.799	0.799	COX41_RAT Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox4i1 PE=1 SV=1
4	P19783	2.20e-101	290	169	0.781	0.781	COX41_MOUSE Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2
5	H3BN72	2.10e-88	256	126	0.734	0.984	H3BN72_HUMAN Cytochrome c oxidase subunit 4 OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
6	H3BNV9	4.93e-88	255	139	0.734	0.892	H3BNV9_HUMAN Cytochrome c oxidase subunit 4 OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
7	Q6TNV0	5.32e-83	244	169	0.633	0.633	Q6TNV0_DANRE Cytochrome c oxidase subunit 4 OS=Danio rerio OX=7955 GN=COX4I1 PE=1 SV=1
8	Q96KJ9	5.62e-53	167	171	0.509	0.503	COX42_HUMAN Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I2 PE=1 SV=2
9	Q86WV2	6.80e-52	162	83	0.473	0.964	Q86WV2_HUMAN COX4I1 protein OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
10	Q91Y94	5.99e-50	160	172	0.497	0.488	COX42_RAT Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox4i2 PE=2 SV=1
11	Q91W29	3.18e-49	158	172	0.462	0.453	COX42_MOUSE Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i2 PE=1 SV=1
12	Q9VIQ8	4.53e-29	107	182	0.308	0.286	Q9VIQ8_DROME Cytochrome c oxidase subunit 4 OS=Drosophila melanogaster OX=7227 GN=COX4 PE=1 SV=1
13	Q9U329	2.31e-13	66.6	175	0.225	0.217	Q9U329_CAEEL Cytochrome c oxidase subunit 4 OS=Caenorhabditis elegans OX=6239 GN=cox-4 PE=1 SV=1
14	O74988	4.20e-06	47.0	186	0.178	0.161	COX5_SCHPO Cytochrome c oxidase polypeptide 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02936 COX4	5.6e-54	193.4	Cytochrome c oxidase subunit IV

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003820896.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806186.1	0.976	Cytochrome c oxidase subunit 5B, mitochondrial
2	9597.XP_003821746.1	0.975	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 621 ESTs, 10 Proteins, and 63% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
3	9597.XP_008955420.1	0.972	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
4	9597.XP_008961706.1	0.972	Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol- cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c ox [...]
5	9597.XP_003807873.1	0.970	Cytochrome b-c1 complex subunit 2, mitochondrial
6	9597.XP_003812052.1	0.966	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 319 ESTs, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
7	9597.XP_003822837.1	0.964	Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol- cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c ox [...]
8	9597.XP_003816209.1	0.963	Belongs to the cytochrome c oxidase subunit 6B.
9	9597.XP_003819481.1	0.963	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 694 ESTs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
10	9597.XP_003829342.1	0.963	Cytochrome b-c1 complex subunit 8
11	9597.XP_003816278.1	0.960	[Cytochrome b-c1 complex subunit Rieske, mitochondrial]: Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b- c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemica [...]
12	9597.XP_003807733.1	0.957	NADH:ubiquinone oxidoreductase subunit B10
13	9597.XP_008964616.1	0.957	ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
14	9597.XP_008972004.1	0.949	NADH:ubiquinone oxidoreductase subunit A9
15	9597.XP_008969959.1	0.941	Cytochrome b-c1 complex subunit 1, mitochondrial
16	9597.XP_003831849.1	0.940	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 2 codons
17	9597.XP_003812798.1	0.933	Cytochrome b-c1 complex subunit 6, mitochondrial isoform X1
18	9597.XP_008949936.1	0.933	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
19	9597.XP_008952191.1	0.916	Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol- cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c ox [...]
20	9597.XP_003807151.1	0.915	Cytochrome c oxidase subunit 6B2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004129	1.000	cytochrome-c oxidase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0044237	0.965	cellular metabolic process
GO:0006091	0.880	generation of precursor metabolites and energy
GO:0050896	0.544	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005746	0.997	mitochondrial respirasome
GO:1902494	0.996	catalytic complex
GO:0098803	0.996	respiratory chain complex
GO:0098800	0.996	inner mitochondrial membrane protein complex
GO:0070013	0.993	intracellular organelle lumen
GO:0070069	0.981	cytochrome complex
GO:0005751	0.970	mitochondrial respiratory chain complex IV
GO:0031981	0.929	nuclear lumen
GO:0005654	0.899	nucleoplasm
GO:0005829	0.597	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11436	1.000	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	1.000	cytochrome-c oxidase.

[back to server]