StarFunc result for job id P13164

User Input

>input (125 residues)
MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYS
VKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQ
EKRGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13164	1.000	1.000	1.005E-18	125	1.000	1.000	P13164.pdb.gz	IFM1_HUMAN Interferon-induced transmembrane protein 1 OS=Homo sapiens OX=9606 GN=IFITM1 PE=1 SV=3
2	AFDB:F1M3Q1	0.368	0.414	1.637E-8	109	0.544	0.624	F1M3Q1.pdb.gz	F1M3Q1_RAT Interferon induced transmembrane protein 1 OS=Rattus norvegicus OX=10116 GN=Ifitm1 PE=3 SV=3
3	AFDB:Q9D103	0.354	0.408	1.287E-7	106	0.536	0.632	Q9D103.pdb.gz	IFM1_MOUSE Interferon-induced transmembrane protein 1 OS=Mus musculus OX=10090 GN=Ifitm1 PE=2 SV=1
4	AFDB:A6NNB3	0.360	0.345	1.028E-5	132	0.320	0.303	A6NNB3.pdb.gz	IFM5_HUMAN Interferon-induced transmembrane protein 5 OS=Homo sapiens OX=9606 GN=IFITM5 PE=1 SV=1
5	AFDB:G3V7W9	0.361	0.341	1.721E-5	134	0.280	0.261	G3V7W9.pdb.gz	G3V7W9_RAT Interferon induced transmembrane protein 5 OS=Rattus norvegicus OX=10116 GN=Ifitm5 PE=3 SV=1
6	AFDB:E7F6S5	0.415	0.314	2.024E-3	177	0.216	0.153	E7F6S5.pdb.gz
7	AFDB:Q2MHH0	0.402	0.311	7.831E-3	173	0.224	0.162	Q2MHH0.pdb.gz	TARG1_RAT Trafficking regulator of GLUT4 1 OS=Rattus norvegicus OX=10116 GN=Trarg1 PE=1 SV=1
8	AFDB:A5PKU2	0.461	0.345	1.229E-2	177	0.240	0.169	A5PKU2.pdb.gz	A5PKU2_HUMAN TUSC5 protein OS=Homo sapiens OX=9606 GN=TUSC5 PE=1 SV=1
9	AFDB:Q8C581	0.477	0.366	6.563E-2	172	0.208	0.151	Q8C581.pdb.gz	TMM91_MOUSE Transmembrane protein 91 OS=Mus musculus OX=10090 GN=Tmem91 PE=2 SV=1
10	AFDB:Q8BFY0	0.285	0.270	3.737E-1	135	0.152	0.141	Q8BFY0.pdb.gz	PIRT_MOUSE Phosphoinositide-interacting protein OS=Mus musculus OX=10090 GN=Pirt PE=1 SV=1
11	PDB:1serB	0.261	0.094	1.967	421	0.088	0.026	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
12	PDB:7enag	0.208	0.162	4.261	166	0.184	0.139	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:3ontA	0.221	0.240	4.544	112	0.120	0.134	3ontA.pdb.gz
14	PDB:6gvwB	0.310	0.182	4.847	262	0.088	0.042	6gvwB.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
15	PDB:6uxwA	0.261	0.053	5.169	778	0.144	0.023	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
16	PDB:5c0wL	0.174	0.187	5.513	113	0.128	0.142	5c0wL.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
17	PDB:7q83D	0.160	0.133	5.513	156	0.088	0.071	7q83D.pdb.gz
18	PDB:7lufB	0.281	0.035	5.880	1054	0.040	0.005	7lufB.pdb.gz	Structural understanding of non-nucleoside inhibition in an elongating herpesvirus polymerase.
19	PDB:7c4jH	0.241	0.139	6.271	242	0.144	0.074	7c4jH.pdb.gz
20	PDB:6d7lA	0.272	0.130	7.608	288	0.080	0.035	6d7lA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13164	8.91e-91	259	125	1.000	1.000	IFM1_HUMAN Interferon-induced transmembrane protein 1 OS=Homo sapiens OX=9606 GN=IFITM1 PE=1 SV=3
2	Q01628	2.71e-57	176	133	0.704	0.662	IFM3_HUMAN Interferon-induced transmembrane protein 3 OS=Homo sapiens OX=9606 GN=IFITM3 PE=1 SV=2
3	E9PQN9	9.08e-56	171	112	0.680	0.759	E9PQN9_HUMAN Interferon induced transmembrane protein 2 OS=Homo sapiens OX=9606 GN=IFITM2 PE=1 SV=1
4	Q6IBB0	1.06e-55	171	132	0.672	0.636	Q6IBB0_HUMAN IFITM2 protein OS=Homo sapiens OX=9606 GN=IFITM2 PE=1 SV=1
5	Q01629	1.50e-55	171	132	0.680	0.644	IFM2_HUMAN Interferon-induced transmembrane protein 2 OS=Homo sapiens OX=9606 GN=IFITM2 PE=1 SV=2
6	Q9CQW9	2.00e-48	153	137	0.576	0.526	IFM3_MOUSE Interferon-induced transmembrane protein 3 OS=Mus musculus OX=10090 GN=Ifitm3 PE=1 SV=1
7	Q9R175	3.59e-47	150	144	0.592	0.514	Q9R175_RAT Interferon induced transmembrane protein 2 OS=Rattus norvegicus OX=10116 GN=Ifitm2 PE=1 SV=1
8	Q99J93	1.41e-46	149	144	0.600	0.521	IFM2_MOUSE Interferon-induced transmembrane protein 2 OS=Mus musculus OX=10090 GN=Ifitm2 PE=1 SV=1
9	F1M3Q1	1.52e-43	140	129	0.544	0.527	F1M3Q1_RAT Interferon induced transmembrane protein 1 OS=Rattus norvegicus OX=10116 GN=Ifitm1 PE=3 SV=3
10	Q9D103	1.82e-42	137	106	0.536	0.632	IFM1_MOUSE Interferon-induced transmembrane protein 1 OS=Mus musculus OX=10090 GN=Ifitm1 PE=2 SV=1
11	A6NNB3	4.43e-20	81.3	132	0.264	0.250	IFM5_HUMAN Interferon-induced transmembrane protein 5 OS=Homo sapiens OX=9606 GN=IFITM5 PE=1 SV=1
12	G3V7W9	3.03e-19	79.3	134	0.272	0.254	G3V7W9_RAT Interferon induced transmembrane protein 5 OS=Rattus norvegicus OX=10116 GN=Ifitm5 PE=3 SV=1
13	O88728	1.32e-18	77.8	134	0.264	0.246	IFM5_MOUSE Interferon-induced transmembrane protein 5 OS=Mus musculus OX=10090 GN=Ifitm5 PE=1 SV=1
14	E9PUL5	1.22e-05	45.1	346	0.192	0.069	PRRT2_MOUSE Proline-rich transmembrane protein 2 OS=Mus musculus OX=10090 GN=Prrt2 PE=1 SV=1
15	Q7Z6L0	1.41e-05	45.1	340	0.192	0.071	PRRT2_HUMAN Proline-rich transmembrane protein 2 OS=Homo sapiens OX=9606 GN=PRRT2 PE=1 SV=1
16	D3ZFB6	1.47e-05	44.7	344	0.192	0.070	PRRT2_RAT Proline-rich transmembrane protein 2 OS=Rattus norvegicus OX=10116 GN=Prrt2 PE=1 SV=1
17	Q6ZNR0	1.1	30.4	172	0.152	0.110	TMM91_HUMAN Transmembrane protein 91 OS=Homo sapiens OX=9606 GN=TMEM91 PE=1 SV=1
18	Q8C581	2.3	29.6	172	0.160	0.116	TMM91_MOUSE Transmembrane protein 91 OS=Mus musculus OX=10090 GN=Tmem91 PE=2 SV=1
19	Q3UHX0	4.7	29.3	1147	0.112	0.012	NOL8_MOUSE Nucleolar protein 8 OS=Mus musculus OX=10090 GN=Nol8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04505 CD225	5.5e-29	111.4	Interferon-induced transmembrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386187

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263645	0.998	CD81 antigen
2	9606.ENSP00000381601	0.992	Interferon-induced GTP-binding protein Mx1
3	9606.ENSP00000368699	0.989	Ubiquitin-like protein ISG15
4	9606.ENSP00000342513	0.985	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
5	9606.ENSP00000395590	0.984	Interferon-induced 35 kDa protein
6	9606.ENSP00000484689	0.983	Interferon-induced transmembrane protein 2
7	9606.ENSP00000342278	0.981	2'-5'-oligoadenylate synthase 2
8	9606.ENSP00000360869	0.980	Interferon-induced protein with tetratricopeptide repeats 1
9	9606.ENSP00000360883	0.977	Interferon-induced protein with tetratricopeptide repeats 3
10	9606.ENSP00000437940	0.976	B-lymphocyte antigen CD19
11	9606.ENSP00000388001	0.975	2'-5'-oligoadenylate synthase 1
12	9606.ENSP00000354394	0.974	Signal transducer and activator of transcription 1-alpha/beta
13	9606.ENSP00000380697	0.974	Interferon regulatory factor 7
14	9606.ENSP00000380073	0.973	Interferon regulatory factor 9
15	9606.ENSP00000382707	0.973	Interferon-induced transmembrane protein 3
16	9606.ENSP00000257570	0.972	2'-5'-oligoadenylate synthase-like protein
17	9606.ENSP00000371471	0.972	Radical S-adenosyl methionine domain-containing protein 2
18	9606.ENSP00000306565	0.971	Interferon-stimulated gene 20 kDa protein
19	9606.ENSP00000333657	0.971	Interferon-induced GTP-binding protein Mx2
20	9606.ENSP00000360891	0.968	Interferon-induced protein with tetratricopeptide repeats 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0044419	0.995	biological process involved in interspecies interaction between organisms
GO:0043207	0.995	response to external biotic stimulus
GO:0051707	0.989	response to other organism
GO:0006952	0.987	defense response
GO:0048519	0.985	negative regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.981	cellular process
GO:1903901	0.975	negative regulation of viral life cycle
GO:0046596	0.975	regulation of viral entry into host cell
GO:0098542	0.968	defense response to other organism
GO:0009615	0.954	response to virus
GO:0002376	0.933	immune system process
GO:0045087	0.906	innate immune response
GO:0045069	0.898	regulation of viral genome replication
GO:0048518	0.894	positive regulation of biological process
GO:0034097	0.894	response to cytokine
GO:0051716	0.889	cellular response to stimulus
GO:0048522	0.852	positive regulation of cellular process
GO:0007154	0.737	cell communication
GO:0023052	0.730	signaling
GO:0048523	0.730	negative regulation of cellular process
GO:0007165	0.711	signal transduction
GO:0042127	0.679	regulation of cell population proliferation
GO:0045071	0.661	negative regulation of viral genome replication
GO:0008285	0.627	negative regulation of cell population proliferation
GO:0007166	0.565	cell surface receptor signaling pathway
GO:0051607	0.463	defense response to virus
GO:0035456	0.379	response to interferon-beta
GO:0040012	0.347	regulation of locomotion
GO:0050793	0.303	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.999	plasma membrane
GO:0031090	0.993	organelle membrane
GO:0032991	0.992	protein-containing complex
GO:0098588	0.981	bounding membrane of organelle
GO:0005634	0.949	nucleus
GO:0012505	0.923	endomembrane system
GO:0005773	0.832	vacuole
GO:0070013	0.818	intracellular organelle lumen
GO:0005654	0.808	nucleoplasm
GO:0000323	0.798	lytic vacuole
GO:0005774	0.789	vacuolar membrane
GO:0005764	0.787	lysosome
GO:0098852	0.776	lytic vacuole membrane
GO:0005765	0.727	lysosomal membrane
GO:0031982	0.510	vesicle
GO:0031410	0.395	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]