StarFunc result for job id P13196

User Input

>input (640 residues)
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKE
TPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPATSQGTASKCPFLAAQMNQRGS
SVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPE
RVSHLLQDNLPKSVSTFQYDRFFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLI
TKKQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHGAGAGGTRNISGTSKFHVDLERELADL
HGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHND
VSHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYG
ARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSSLIDTVRSYAAGFIFTTSLPPM
LLAGALESVRILKSAEGRVLRRQHQRNVKLMRQMLMDAGLPVVHCPSHIIPVRVADAAKN
TEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLE
LKPHSSAECNFCRRPLHFEVMSEREKSYFSGLSKLVSAQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13195	0.729	0.727	1.774E-103	642	0.903	0.900	P13195.pdb.gz	HEM1_RAT 5-aminolevulinate synthase, non-specific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas1 PE=2 SV=2
2	AFDB:P07997	0.734	0.740	1.406E-95	635	0.831	0.838	P07997.pdb.gz	HEM1_CHICK 5-aminolevulinate synthase, non-specific, mitochondrial OS=Gallus gallus OX=9031 GN=ALAS1 PE=1 SV=2
3	AFDB:Q7T2F0	0.721	0.752	2.995E-88	613	0.705	0.736	Q7T2F0.pdb.gz	Q7T2F0_DANRE 5-aminolevulinate synthase OS=Danio rerio OX=7955 GN=wu:fb58d01 PE=1 SV=1
4	AFDB:P08680	0.700	0.762	2.528E-74	587	0.570	0.622	P08680.pdb.gz	HEM0_MOUSE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Mus musculus OX=10090 GN=Alas2 PE=1 SV=3
5	AFDB:Q9YHT4	0.670	0.734	1.045E-73	583	0.575	0.631	Q9YHT4.pdb.gz	HEM0_DANRE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Danio rerio OX=7955 GN=alas2 PE=2 SV=1
6	AFDB:O18680	0.658	0.779	5.736E-66	539	0.452	0.536	O18680.pdb.gz	O18680_DROME 5-aminolevulinate synthase OS=Drosophila melanogaster OX=7227 GN=Alas PE=2 SV=1
7	AFDB:P18080	0.658	0.819	1.747E-59	513	0.405	0.505	P18080.pdb.gz	HEM0_CHICK 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Gallus gallus OX=9031 GN=ALAS2 PE=2 SV=2
8	AFDB:A2R9H8	0.628	0.620	3.842E-54	649	0.370	0.365	A2R9H8.pdb.gz	A2R9H8_ASPNC 5-aminolevulinate synthase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An17g01480 PE=3 SV=1
9	AFDB:O14092	0.622	0.713	3.495E-53	558	0.355	0.407	O14092.pdb.gz	HEM1_SCHPO 5-aminolevulinate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem1 PE=3 SV=1
10	AFDB:O94069	0.623	0.706	7.142E-50	564	0.319	0.362	O94069.pdb.gz	HEM1_CANAL 5-aminolevulinate synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HEM1 PE=3 SV=2
11	PDB:5txrA	0.614	0.817	4.903E-47	479	0.292	0.390	5txrA.pdb.gz	Structure of the Mitochondrial Aminolevulinic Acid Synthase, a Key Heme Biosynthetic Enzyme.
12	PDB:1fc4A	0.583	0.919	3.284E-35	401	0.192	0.307	1fc4A.pdb.gz	Three-dimensional structure of 2-amino-3-ketobutyrate CoA ligase from Escherichia coli complexed with a PLP-substrate intermediate: inferred reaction mechanism.
13	PDB:7poaA	0.591	0.936	3.498E-34	398	0.191	0.307	7poaA.pdb.gz	An Irreversible, Promiscuous and Highly Thermostable Claisen-Condensation Biocatalyst Drives the Synthesis of Substituted Pyrroles
14	PDB:1dj9A	0.567	0.933	1.315E-32	383	0.186	0.311	1dj9A.pdb.gz	Mechanism of 8-amino-7-oxononanoate synthase: spectroscopic, kinetic, and crystallographic studies.
15	PDB:7k0mA	0.547	0.747	3.647E-30	464	0.167	0.231	7k0mA.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
16	PDB:7cqiT	0.583	0.740	1.222E-29	498	0.184	0.237	7cqiT.pdb.gz	Structural insights into the assembly and substrate selectivity of human SPT-ORMDL3 complex.
17	PDB:3ntjB	0.452	0.700	3.278E-15	393	0.100	0.163	3ntjB.pdb.gz
18	PDB:5eudA	0.451	0.614	6.493E-15	454	0.113	0.159	5eudA.pdb.gz	Creation of a S1P Lyase bacterial surrogate for structure-based drug design.
19	PDB:2hufA	0.415	0.656	6.843E-15	385	0.087	0.145	2hufA.pdb.gz	Crystal Structures of Aedes aegypti Alanine Glyoxylate Aminotransferase.
20	PDB:4adeB	0.432	0.743	7.213E-15	350	0.098	0.180	4adeB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O18680	0.0	558	539	0.420	0.499	O18680_DROME 5-aminolevulinate synthase OS=Drosophila melanogaster OX=7227 GN=Alas PE=2 SV=1
2	P07997	0.0	1048	635	0.825	0.831	HEM1_CHICK 5-aminolevulinate synthase, non-specific, mitochondrial OS=Gallus gallus OX=9031 GN=ALAS1 PE=1 SV=2
3	P08680	0.0	739	587	0.573	0.625	HEM0_MOUSE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Mus musculus OX=10090 GN=Alas2 PE=1 SV=3
4	P13195	0.0	1206	642	0.905	0.902	HEM1_RAT 5-aminolevulinate synthase, non-specific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas1 PE=2 SV=2
5	P13196	0.0	1337	640	1.000	1.000	HEM1_HUMAN 5-aminolevulinate synthase, non-specific, mitochondrial OS=Homo sapiens OX=9606 GN=ALAS1 PE=1 SV=2
6	P22557	0.0	737	587	0.556	0.606	HEM0_HUMAN 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Homo sapiens OX=9606 GN=ALAS2 PE=1 SV=2
7	Q5JAM2	0.0	1337	640	1.000	1.000	Q5JAM2_HUMAN 5-aminolevulinate synthase OS=Homo sapiens OX=9606 GN=ALAS1 PE=2 SV=1
8	Q63147	0.0	734	587	0.572	0.624	HEM0_RAT 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas2 PE=1 SV=1
9	Q7T2F0	0.0	953	613	0.709	0.741	Q7T2F0_DANRE 5-aminolevulinate synthase OS=Danio rerio OX=7955 GN=wu:fb58d01 PE=1 SV=1
10	Q8T4G6	0.0	558	539	0.420	0.499	Q8T4G6_DROME 5-aminolevulinate synthase OS=Drosophila melanogaster OX=7227 GN=Alas PE=2 SV=1
11	Q8VC19	0.0	1211	642	0.917	0.914	HEM1_MOUSE 5-aminolevulinate synthase, non-specific, mitochondrial OS=Mus musculus OX=10090 GN=Alas1 PE=1 SV=2
12	Q9YHT4	0.0	743	583	0.584	0.642	HEM0_DANRE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Danio rerio OX=7955 GN=alas2 PE=2 SV=1
13	P18080	1.10e-168	493	513	0.419	0.522	HEM0_CHICK 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Gallus gallus OX=9031 GN=ALAS2 PE=2 SV=2
14	A2R9H8	9.85e-140	424	649	0.330	0.325	A2R9H8_ASPNC 5-aminolevulinate synthase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An17g01480 PE=3 SV=1
15	O14092	7.43e-130	395	558	0.314	0.360	HEM1_SCHPO 5-aminolevulinate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem1 PE=3 SV=1
16	O94069	1.63e-129	394	564	0.298	0.339	HEM1_CANAL 5-aminolevulinate synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HEM1 PE=3 SV=2
17	P09950	2.46e-124	380	548	0.294	0.343	HEM1_YEAST 5-aminolevulinate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEM1 PE=1 SV=1
18	Q8I4X1	4.49e-92	299	630	0.233	0.237	Q8I4X1_PLAF7 5-aminolevulinate synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246100 PE=3 SV=1
19	P0AB77	4.42e-61	210	398	0.194	0.312	KBL_ECOLI 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli (strain K12) OX=83333 GN=kbl PE=1 SV=1
20	O88986	1.84e-60	209	416	0.186	0.286	KBL_MOUSE 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Mus musculus OX=10090 GN=Gcat PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	7.4e-74	260.7	Aminotransferase class I and II
2	PF00266 Aminotran_5	2	18.9	Aminotransferase class-V
3	PF01212 Beta_elim_lyase	75	14.1	Beta-eliminating lyase
4	PF01053 Cys_Met_Meta_PP	0.11	22.6	Cys/Met metabolism PLP-dependent enzyme
5	PF09029 Preseq_ALAS	9.2e-43	156.6	5-aminolevulinate synthase presequence

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386284	0.985	Delta-aminolevulinic acid dehydratase
2	9606.ENSP00000262188	0.941	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
3	9606.ENSP00000333667	0.940	Serine hydroxymethyltransferase, mitochondrial
4	9606.ENSP00000318868	0.928	Serine hydroxymethyltransferase, cytosolic
5	9606.ENSP00000385523	0.927	Peroxisome proliferator-activated receptor alpha
6	9606.ENSP00000228476	0.922	D-amino-acid oxidase
7	9606.ENSP00000419692	0.922	Retinoic acid receptor RXR-alpha
8	9606.ENSP00000370737	0.921	Glycine dehydrogenase (decarboxylating), mitochondrial
9	9606.ENSP00000360938	0.918	Sarcosine dehydrogenase, mitochondrial
10	9606.ENSP00000379895	0.914	Glycine amidinotransferase, mitochondrial
11	9606.ENSP00000302620	0.913	Alanine-glyoxylate aminotransferase
12	9606.ENSP00000317721	0.911	Peroxisomal sarcosine oxidase
13	9606.ENSP00000325690	0.910	Histone-arginine methyltransferase CARM1
14	9606.ENSP00000376924	0.910	Nuclear respiratory factor 1
15	9606.ENSP00000231420	0.909	Alanine--glyoxylate aminotransferase 2, mitochondrial
16	9606.ENSP00000384851	0.909	Steroid hormone receptor ERR1
17	9606.ENSP00000217964	0.907	F-box-like/WD repeat-containing protein TBL1X
18	9606.ENSP00000385216	0.905	Nuclear receptor coactivator 1
19	9606.ENSP00000312649	0.903	Peroxisome proliferator-activated receptor gamma coactivator 1-beta
20	9606.ENSP00000417401	0.903	Helicase with zinc finger domain 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016410	1.000	N-acyltransferase activity
GO:0005488	0.981	binding
GO:0003870	0.966	5-aminolevulinate synthase activity
GO:0005515	0.951	protein binding
GO:0097159	0.861	organic cyclic compound binding
GO:1901363	0.856	heterocyclic compound binding
GO:0043167	0.695	ion binding
GO:0036094	0.586	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0044237	0.984	cellular metabolic process
GO:0071704	0.968	organic substance metabolic process
GO:0050896	0.927	response to stimulus
GO:0006807	0.909	nitrogen compound metabolic process
GO:1901564	0.795	organonitrogen compound metabolic process
GO:0006725	0.741	cellular aromatic compound metabolic process
GO:1901360	0.692	organic cyclic compound metabolic process
GO:0042221	0.668	response to chemical
GO:0046483	0.653	heterocycle metabolic process
GO:0009058	0.650	biosynthetic process
GO:0010033	0.641	response to organic substance
GO:0033013	0.641	tetrapyrrole metabolic process
GO:0044238	0.573	primary metabolic process
GO:0034641	0.553	cellular nitrogen compound metabolic process
GO:1901576	0.546	organic substance biosynthetic process
GO:0044249	0.524	cellular biosynthetic process
GO:0014070	0.489	response to organic cyclic compound
GO:1901700	0.451	response to oxygen-containing compound
GO:0006778	0.406	porphyrin-containing compound metabolic process
GO:0042168	0.382	heme metabolic process
GO:1901362	0.350	organic cyclic compound biosynthetic process
GO:0046148	0.340	pigment biosynthetic process
GO:0044271	0.338	cellular nitrogen compound biosynthetic process
GO:0065007	0.326	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005654	0.997	nucleoplasm
GO:0005829	0.988	cytosol
GO:0005759	0.360	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:12921	0.966	glycine + H(+) + succinyl-CoA = 5-aminolevulinate + CO2 + CoA
EC:2.3.1.37	0.966	5-aminolevulinate synthase.

[back to server]