StarFunc result for job id P13232

User Input

>input (177 residues)
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL
NNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQ
VKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13232	1.000	1.000	2.186E-28	177	1.000	1.000	P13232.pdb.gz	IL7_HUMAN Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=1 SV=1
2	AFDB:P10168	0.710	0.810	1.558E-15	154	0.576	0.662	P10168.pdb.gz	IL7_MOUSE Interleukin-7 OS=Mus musculus OX=10090 GN=Il7 PE=1 SV=1
3	AFDB:P56478	0.688	0.785	1.558E-15	154	0.588	0.675	P56478.pdb.gz	IL7_RAT Interleukin-7 OS=Rattus norvegicus OX=10116 GN=Il7 PE=2 SV=1
4	PDB:3di3A	0.547	0.806	3.557E-10	118	0.621	0.932	3di3A.pdb.gz
5	PDB:7z0lB	0.305	0.187	6.435E-2	370	0.169	0.081	7z0lB.pdb.gz
6	AFDB:Q8VY27	0.226	0.071	1.846E-1	636	0.073	0.020	Q8VY27.pdb.gz	E70H1_ARATH Exocyst complex component EXO70H1 OS=Arabidopsis thaliana OX=3702 GN=EXO70H1 PE=1 SV=1
7	AFDB:B4ER10	0.326	0.314	2.177E-1	186	0.119	0.113	B4ER10.pdb.gz	IFNL3_CHICK Interferon lambda-3 OS=Gallus gallus OX=9031 GN=IFNL3 PE=2 SV=1
8	AFDB:Q9JKV9	0.225	0.226	2.431E-1	176	0.130	0.131	Q9JKV9.pdb.gz	IL20_MOUSE Interleukin-20 OS=Mus musculus OX=10090 GN=Il20 PE=2 SV=1
9	AFDB:Q9NPF7	0.318	0.302	6.556E-1	189	0.141	0.132	Q9NPF7.pdb.gz	IL23A_HUMAN Interleukin-23 subunit alpha OS=Homo sapiens OX=9606 GN=IL23A PE=1 SV=1
10	AFDB:W5PH94	0.383	0.309	6.556E-1	231	0.181	0.139	W5PH94.pdb.gz	W5PH94_SHEEP Prolactin OS=Ovis aries OX=9940 GN=PRL PE=3 SV=1
11	PDB:7nsuD	0.249	0.121	6.883E-1	420	0.119	0.050	7nsuD.pdb.gz
12	AFDB:P0DML2	0.426	0.363	6.928E-1	217	0.130	0.106	P0DML2.pdb.gz	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
13	AFDB:B5L331	0.300	0.286	7.320E-1	191	0.136	0.126	B5L331.pdb.gz	B5L331_DANRE Thrombopoietin OS=Danio rerio OX=7955 GN=Tpo PE=2 SV=1
14	PDB:4zs7A	0.406	0.498	1.070	139	0.130	0.165	4zs7A.pdb.gz
15	PDB:6df3C	0.286	0.315	1.262	155	0.113	0.129	6df3C.pdb.gz
16	PDB:5mj4B	0.420	0.452	1.489	162	0.141	0.154	5mj4B.pdb.gz
17	PDB:7u7nD	0.281	0.268	1.573	191	0.141	0.131	7u7nD.pdb.gz
18	PDB:3u44A	0.236	0.051	1.856	1122	0.130	0.020	3u44A.pdb.gz	Insights into Chi recognition from the structure of an AddAB-type helicase-nuclease complex.
19	PDB:5cd4I	0.109	0.052	1.961	494	0.096	0.034	5cd4I.pdb.gz	Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
20	PDB:1bp3A	0.409	0.392	2.072	186	0.119	0.113	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13232	2.61e-130	364	177	1.000	1.000	IL7_HUMAN Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=1 SV=1
2	P10168	2.30e-69	209	154	0.605	0.695	IL7_MOUSE Interleukin-7 OS=Mus musculus OX=10090 GN=Il7 PE=1 SV=1
3	P56478	5.63e-68	205	154	0.610	0.701	IL7_RAT Interleukin-7 OS=Rattus norvegicus OX=10116 GN=Il7 PE=2 SV=1
4	Q9LPD9	0.079	35.4	936	0.164	0.031	MCM2_ARATH DNA replication licensing factor MCM2 OS=Arabidopsis thaliana OX=3702 GN=MCM2 PE=1 SV=1
5	E1BSN7	2.0	31.2	843	0.102	0.021	E1BSN7_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=PYGB PE=1 SV=2
6	Q5ZME4	2.0	31.2	843	0.102	0.021	Q5ZME4_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=RCJMB04_2f16 PE=2 SV=1
7	Q9XUE5	3.3	30.8	741	0.107	0.026	Q9XUE5_CAEEL PAN domain protein OS=Caenorhabditis elegans OX=6239 GN=noah-2 PE=1 SV=1
8	Q8LFN9	4.0	30.0	336	0.141	0.074	AGD13_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana OX=3702 GN=AGD13 PE=2 SV=1
9	D3YVF0	4.7	30.0	745	0.079	0.019	AKAP5_MOUSE A-kinase anchor protein 5 OS=Mus musculus OX=10090 GN=Akap5 PE=1 SV=2
10	P24587	4.7	30.0	714	0.079	0.020	AKAP5_RAT A-kinase anchor protein 5 OS=Rattus norvegicus OX=10116 GN=Akap5 PE=1 SV=2
11	Q8CI94	5.3	30.0	843	0.085	0.018	PYGB_MOUSE Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3
12	Q8H104	6.2	29.6	532	0.102	0.034	SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g26870 PE=2 SV=1
13	P53534	6.8	29.6	838	0.085	0.018	PYGB_RAT Glycogen phosphorylase, brain form (Fragment) OS=Rattus norvegicus OX=10116 GN=Pygb PE=1 SV=3
14	Q86WI1	6.8	29.6	4243	0.073	0.003	PKHL1_HUMAN Fibrocystin-L OS=Homo sapiens OX=9606 GN=PKHD1L1 PE=2 SV=2
15	Q80ZA4	7.8	29.6	4249	0.073	0.003	PKHL1_MOUSE Fibrocystin-L OS=Mus musculus OX=10090 GN=Pkhd1l1 PE=1 SV=1
16	Q63746	8.1	29.3	314	0.164	0.092	IKBA_RAT NF-kappa-B inhibitor alpha OS=Rattus norvegicus OX=10116 GN=Nfkbia PE=2 SV=1
17	Q4KCD7	9.7	29.3	4937	0.079	0.003	Q4KCD7_PSEF5 Polyketide synthase RzxC OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=rzxC PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01415 IL7	1.4e-57	204.8	Interleukin 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002528

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000019361	0.999	Interleukin 7 receptor
2	61853.ENSNLEP00000001373	0.976	Interleukin 2 receptor, gamma
3	61853.ENSNLEP00000018412	0.868	Janus kinase 1
4	61853.ENSNLEP00000010932	0.829	Janus kinase 2
5	61853.ENSNLEP00000023996	0.821	Hepatocyte growth factor (hepapoietin A
6	61853.ENSNLEP00000007120	0.817	Janus kinase 3
7	61853.ENSNLEP00000014170	0.806	Interleukin 2 receptor, alpha
8	61853.ENSNLEP00000023425	0.767	Interleukin 15
9	61853.ENSNLEP00000013916	0.762	Signal transducer and activator of transcription 5B
10	61853.ENSNLEP00000003540	0.740	CD8a molecule
11	61853.ENSNLEP00000011216	0.733	Interleukin 23 receptor
12	61853.ENSNLEP00000011248	0.718	Interleukin 12 receptor, beta 2
13	61853.ENSNLEP00000014149	0.699	Interleukin 15 receptor, alpha
14	61853.ENSNLEP00000014201	0.697	Interleukin 4 receptor
15	61853.ENSNLEP00000001776	0.696	Colony stimulating factor 3 (granulocyte)
16	61853.ENSNLEP00000023500	0.695	Interleukin 21 receptor
17	61853.ENSNLEP00000006667	0.693	Kit ligand
18	61853.ENSNLEP00000000929	0.691	Interleukin 10
19	61853.ENSNLEP00000004697	0.691	Interleukin 17A
20	61853.ENSNLEP00000005682	0.691	CD4 molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity
GO:0005126	0.999	cytokine receptor binding
GO:0070851	0.998	growth factor receptor binding
GO:0005139	0.942	interleukin-7 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.996	cellular process
GO:0050896	0.993	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0023052	0.988	signaling
GO:0048518	0.985	positive regulation of biological process
GO:0007166	0.979	cell surface receptor signaling pathway
GO:0019222	0.956	regulation of metabolic process
GO:0048522	0.952	positive regulation of cellular process
GO:0060255	0.949	regulation of macromolecule metabolic process
GO:0042221	0.940	response to chemical
GO:0009893	0.939	positive regulation of metabolic process
GO:0048583	0.938	regulation of response to stimulus
GO:0071310	0.932	cellular response to organic substance
GO:0051239	0.927	regulation of multicellular organismal process
GO:0010604	0.927	positive regulation of macromolecule metabolic process
GO:0032502	0.919	developmental process
GO:0048856	0.913	anatomical structure development
GO:0008284	0.913	positive regulation of cell population proliferation
GO:0002376	0.912	immune system process
GO:0048584	0.902	positive regulation of response to stimulus
GO:0010468	0.900	regulation of gene expression
GO:0051240	0.891	positive regulation of multicellular organismal process
GO:0009966	0.886	regulation of signal transduction
GO:0071345	0.883	cellular response to cytokine stimulus
GO:0001817	0.879	regulation of cytokine production
GO:0010628	0.875	positive regulation of gene expression
GO:0023056	0.847	positive regulation of signaling
GO:0006955	0.800	immune response
GO:0010647	0.745	positive regulation of cell communication
GO:0009967	0.625	positive regulation of signal transduction
GO:0032501	0.586	multicellular organismal process
GO:0002682	0.547	regulation of immune system process
GO:0080090	0.494	regulation of primary metabolic process
GO:0051171	0.494	regulation of nitrogen compound metabolic process
GO:0048519	0.493	negative regulation of biological process
GO:0001819	0.482	positive regulation of cytokine production
GO:0019221	0.482	cytokine-mediated signaling pathway
GO:0048523	0.465	negative regulation of cellular process
GO:0031323	0.440	regulation of cellular metabolic process
GO:0009605	0.393	response to external stimulus
GO:0051173	0.388	positive regulation of nitrogen compound metabolic process
GO:0006950	0.380	response to stress
GO:0002684	0.379	positive regulation of immune system process
GO:0031325	0.346	positive regulation of cellular metabolic process
GO:0051246	0.315	regulation of protein metabolic process
GO:0060759	0.305	regulation of response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005576	0.999	extracellular region
GO:0005886	0.934	plasma membrane
GO:0005615	0.818	extracellular space
GO:0030312	0.789	external encapsulating structure
GO:0031012	0.731	extracellular matrix
GO:0062023	0.624	collagen-containing extracellular matrix
GO:0005622	0.558	intracellular anatomical structure
GO:0043226	0.538	organelle
GO:0005737	0.532	cytoplasm
GO:0043229	0.507	intracellular organelle
GO:0043227	0.378	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]