StarFunc result for job id P13236

User Input

>input (92 residues)
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13236	1.000	1.000	9.682E-17	92	1.000	1.000	P13236.pdb.gz	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
2	AFDB:P14097	0.725	0.725	7.346E-14	92	0.761	0.761	P14097.pdb.gz	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
3	AFDB:P50230	0.730	0.730	3.184E-13	92	0.772	0.772	P50230.pdb.gz	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
4	AFDB:P16619	0.690	0.682	5.983E-12	93	0.587	0.581	P16619.pdb.gz	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
5	AFDB:P10855	0.683	0.683	5.230E-11	92	0.609	0.609	P10855.pdb.gz	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
6	AFDB:P50229	0.686	0.686	1.756E-10	92	0.554	0.554	P50229.pdb.gz	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
7	AFDB:P13501	0.665	0.672	2.575E-10	91	0.435	0.440	P13501.pdb.gz	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
8	PDB:1humA	0.657	0.857	3.253E-10	69	0.750	1.000	1humA.pdb.gz
9	AFDB:P50231	0.820	0.820	4.289E-10	92	0.457	0.457	P50231.pdb.gz	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
10	AFDB:Q16627	0.673	0.666	9.219E-10	93	0.402	0.398	Q16627.pdb.gz	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
11	PDB:4zltF	0.634	0.926	1.820E-9	62	0.478	0.710	4zltF.pdb.gz
12	AFDB:Q4KS30	0.666	0.683	2.112E-9	89	0.446	0.461	Q4KS30.pdb.gz	Q4KS30_CHICK Chemokine K203 OS=Gallus gallus OX=9031 PE=4 SV=1
13	PDB:7f1qR	0.631	0.165	2.332E-8	367	0.478	0.120	7f1qR.pdb.gz
14	PDB:7f1tA	0.635	0.141	3.644E-8	423	0.467	0.102	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
15	PDB:2q8tB	0.661	0.927	6.468E-8	65	0.359	0.508	2q8tB.pdb.gz
16	PDB:5yamA	0.625	0.807	1.579E-7	69	0.402	0.536	5yamA.pdb.gz
17	PDB:1esrA	0.662	0.793	6.846E-7	76	0.283	0.342	1esrA.pdb.gz
18	PDB:4mheA	0.610	0.800	6.846E-7	69	0.337	0.449	4mheA.pdb.gz
19	PDB:2ra4B	0.629	0.877	1.568E-6	65	0.283	0.400	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
20	PDB:6fgpB	0.591	0.774	2.157E-6	68	0.337	0.456	6fgpB.pdb.gz	The solution structure of monomeric CCL5 in complex with a doubly sulfated N-terminal segment of CCR5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13236	2.05e-63	188	92	1.000	1.000	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
2	Q8NHW4	6.04e-61	182	92	0.967	0.967	CC4L_HUMAN C-C motif chemokine 4-like OS=Homo sapiens OX=9606 GN=CCL4L1 PE=1 SV=1
3	P50230	7.03e-50	154	92	0.772	0.772	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
4	P14097	6.75e-42	134	92	0.761	0.761	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
5	P10855	3.35e-39	127	92	0.609	0.609	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
6	P16619	1.47e-38	125	93	0.587	0.581	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
7	P50229	6.27e-37	121	92	0.576	0.576	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
8	P10147	9.11e-36	118	92	0.576	0.576	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1
9	Q9I8E0	9.82e-27	95.5	89	0.489	0.506	Q9I8E0_CHICK Chemokine C-C motif ligand 4 OS=Gallus gallus OX=9031 GN=K203 PE=2 SV=1
10	P30882	1.57e-26	95.1	91	0.489	0.495	CCL5_MOUSE C-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Ccl5 PE=1 SV=2
11	Q4KS30	1.79e-26	95.1	89	0.478	0.494	Q4KS30_CHICK Chemokine K203 OS=Gallus gallus OX=9031 PE=4 SV=1
12	Q16627	1.49e-25	92.8	93	0.435	0.430	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
13	P50231	2.09e-24	89.7	92	0.457	0.457	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
14	P13501	7.97e-24	88.2	91	0.457	0.462	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
15	P55774	8.89e-22	83.2	89	0.435	0.449	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
16	Q99616	1.31e-20	80.5	98	0.391	0.367	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
17	P14844	1.89e-19	79.0	148	0.424	0.264	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
18	P10148	1.41e-17	73.9	148	0.402	0.250	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
19	Q9Y258	2.07e-16	69.7	94	0.348	0.340	CCL26_HUMAN C-C motif chemokine 26 OS=Homo sapiens OX=9606 GN=CCL26 PE=1 SV=1
20	P48298	9.02e-16	68.2	97	0.380	0.361	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	1.5e-16	71.6	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292303	0.999	C-C chemokine receptor type 5
2	9606.ENSP00000477908	0.998	C-C motif chemokine 3
3	9606.ENSP00000263341	0.995	Interleukin-1 beta
4	9606.ENSP00000398698	0.992	Tumor necrosis factor
5	9606.ENSP00000296140	0.990	C-C chemokine receptor type 1
6	9606.ENSP00000385675	0.988	Interleukin-6
7	9606.ENSP00000412237	0.988	Interleukin-10
8	9606.ENSP00000225474	0.986	Granulocyte colony-stimulating factor
9	9606.ENSP00000296871	0.986	Granulocyte-macrophage colony-stimulating factor
10	9606.ENSP00000263339	0.984	Interleukin-1 alpha
11	9606.ENSP00000441600	0.980	C-C chemokine receptor type 3
12	9606.ENSP00000480558	0.975	C-C motif chemokine 3-like 1
13	9606.ENSP00000280357	0.969	Interleukin-18
14	9606.ENSP00000386884	0.969	C-X-C chemokine receptor type 4
15	9606.ENSP00000305651	0.968	C-X-C motif chemokine 10
16	9606.ENSP00000379140	0.967	Stromal cell-derived factor 1
17	9606.ENSP00000306512	0.964	Interleukin-8
18	9606.ENSP00000292301	0.959	C-C chemokine receptor type 2
19	9606.ENSP00000444986	0.941	Tyrosine-protein kinase HCK
20	9606.ENSP00000363117	0.939	Tyrosine-protein kinase Fgr

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.798	CCR chemokine receptor binding
GO:0042802	0.335	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050789	0.996	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0051716	0.986	cellular response to stimulus
GO:0048522	0.978	positive regulation of cellular process
GO:0006954	0.968	inflammatory response
GO:0042221	0.967	response to chemical
GO:0002376	0.964	immune system process
GO:0048583	0.953	regulation of response to stimulus
GO:0009605	0.940	response to external stimulus
GO:0050900	0.928	leukocyte migration
GO:0040012	0.922	regulation of locomotion
GO:0040017	0.911	positive regulation of locomotion
GO:0060255	0.895	regulation of macromolecule metabolic process
GO:0070887	0.891	cellular response to chemical stimulus
GO:0032501	0.890	multicellular organismal process
GO:0006935	0.889	chemotaxis
GO:0002685	0.884	regulation of leukocyte migration
GO:0030335	0.861	positive regulation of cell migration
GO:0023052	0.848	signaling
GO:0002684	0.839	positive regulation of immune system process
GO:0007165	0.837	signal transduction
GO:0032103	0.828	positive regulation of response to external stimulus
GO:0002687	0.783	positive regulation of leukocyte migration
GO:0051240	0.775	positive regulation of multicellular organismal process
GO:0050920	0.733	regulation of chemotaxis
GO:0002688	0.710	regulation of leukocyte chemotaxis
GO:0050921	0.706	positive regulation of chemotaxis
GO:0044419	0.698	biological process involved in interspecies interaction between organisms
GO:0071675	0.693	regulation of mononuclear cell migration
GO:0010468	0.675	regulation of gene expression
GO:0002690	0.675	positive regulation of leukocyte chemotaxis
GO:0048519	0.665	negative regulation of biological process
GO:0032879	0.662	regulation of localization
GO:0009893	0.630	positive regulation of metabolic process
GO:0010604	0.598	positive regulation of macromolecule metabolic process
GO:0051702	0.586	biological process involved in interaction with symbiont
GO:0009607	0.573	response to biotic stimulus
GO:0006955	0.564	immune response
GO:0048523	0.555	negative regulation of cellular process
GO:0071677	0.539	positive regulation of mononuclear cell migration
GO:0009410	0.531	response to xenobiotic stimulus
GO:0060326	0.530	cell chemotaxis
GO:0051851	0.525	modulation by host of symbiont process
GO:0009966	0.496	regulation of signal transduction
GO:2000403	0.464	positive regulation of lymphocyte migration
GO:0010033	0.433	response to organic substance
GO:0051707	0.432	response to other organism
GO:0042127	0.414	regulation of cell population proliferation
GO:0051049	0.400	regulation of transport
GO:0001817	0.375	regulation of cytokine production
GO:0080090	0.372	regulation of primary metabolic process
GO:0031323	0.371	regulation of cellular metabolic process
GO:0051171	0.364	regulation of nitrogen compound metabolic process
GO:0080134	0.336	regulation of response to stress
GO:0032502	0.327	developmental process
GO:0023056	0.321	positive regulation of signaling
GO:0010647	0.321	positive regulation of cell communication
GO:0034097	0.315	response to cytokine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0005622	0.719	intracellular anatomical structure
GO:0005737	0.707	cytoplasm
GO:0071944	0.509	cell periphery
GO:0005886	0.457	plasma membrane
GO:0043231	0.412	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]